PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g05450.1
Common NameLOC4328295, Os02g0147800, OsJ_05372, OSNPB_020147800, P0479D12.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HB-other
Protein Properties Length: 682aa    MW: 76150.9 Da    PI: 7.4478
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g05450.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.5e-09445490752
                       --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       + +  +e+L ++F++n  p ++ +e L+++lg++ +++  WF+N R
  LOC_Os02g05450.1 445 IPPAAVEVLRKAFAENELPARSVKENLSTELGISFEKIDKWFKNTR 490
                       567789**************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.55E-8182253IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.8E-7194252IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS500168.805195251IPR019787Zinc finger, PHD-finger
Gene3DG3DSA:1.10.10.607.5E-12427490IPR009057Homeodomain-like
PROSITE profilePS5007112.26436496IPR001356Homeobox domain
SuperFamilySSF466891.15E-9438502IPR009057Homeodomain-like
SMARTSM003893.7E-9438500IPR001356Homeobox domain
CDDcd000862.76E-8439500No hitNo description
PfamPF000461.0E-6444490IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MNTPEKKPLC YTSRRALQQR TESSSELISV SKRATRQNTP RKPDSPPKRT TRSSANLAKC  60
IENKHHSSPL KRRRGSDAAT GKSATGPTRR KHKQKRKNDE SDEVSRMEKR ARYLLIKIKQ  120
EQNLLDAYSG DGWNGHSREK IKPEKELQRA KKQIMKYKIA IRDVIHQLDL CSSSGSKDDS  180
VIPPDGCHES VNPEHTICSR CKSHESFPDN NIIFCEGGCK LACHQKCLEP PFDKILPTTR  240
HGRLCKHCSS KMKILDAINA HLGTSFTVKC PSSDIFKEAA EHFNSDDGLG QDWLSEYSGD  300
EDYDPEENEA SSSGEENKSA DSNCSGSPLY SPNDDIPDFI SADFNDAEGF CRESSNLGID  360
FGEDGLAEIL THQRPRRDVD YTQLNEQMFG EPIGNDEQSE DEDWGLNKRK KRRTGSTGVG  420
TNSVEGRSDV KSNKKAQPRR KLFRIPPAAV EVLRKAFAEN ELPARSVKEN LSTELGISFE  480
KIDKWFKNTR CAALRDRKGE SRYSGPSKRS RTSIEKAETS AKVDQMDNSC FLPLSEIINV  540
PTRLQKGLDK KPKSINSPPR PQDNETCLSP TDKTKEGTPP TIKPSITDSS QLMNNNIGTE  600
ETAVSWVDTW ASDALHFLDV SDDEHFFDVI EKVCGLENRL QRLKENMLSS SSSTDNNVAA  660
ESGLQNEVVL VPAAELKDKA S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.73300.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329805260.0
Expression AtlasQ6Z441-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g05450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g05450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402070.0FJ940207.1 Oryza sativa Japonica Group clone KCS002D03 homeodomain protein mRNA, complete cds.
GenBankAK0988550.0AK098855.1 Oryza sativa Japonica Group cDNA clone:J013000I05, full insert sequence.
GenBankAK0705020.0AK070502.1 Oryza sativa Japonica Group cDNA clone:J023051F17, full insert sequence.
GenBankAK0652570.0AK065257.1 Oryza sativa Japonica Group cDNA clone:J013002J16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626817.10.0PREDICTED: pathogenesis-related homeodomain protein
TrEMBLA0A0E0N9U10.0A0A0E0N9U1_ORYRU; Uncharacterized protein
TrEMBLB8AHR50.0B8AHR5_ORYSI; Putative uncharacterized protein
TrEMBLQ6Z4410.0Q6Z441_ORYSJ; Homeodomain protein
STRINGLOC_Os02g05450.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA007535-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18301539
MonocotsOGMP85502227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.23e-56pathogenesis related homeodomain protein A
Publications ? help Back to Top
  1. Ye R,Yao QH,Xu ZH,Xue HW
    Development of an efficient method for the isolation of factors involved in gene transcription during rice embryo development.
    Plant J., 2004. 38(2): p. 348-57
    [PMID:15078336]