PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g04640.1
Common NameLOC4328249, Os02g0139000, OsJ_05314, OSJNBa0026E05.31, PHR3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 468aa    MW: 51874.9 Da    PI: 5.6557
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g04640.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37.3e-33265319155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kprlrWtpeLHerFv+av++L G+ekAtPk +l+lmkv+gLt++h+kSHLQkYRl
  LOC_Os02g04640.1 265 KPRLRWTPELHERFVDAVNKLEGPEKATPKGVLKLMKVEGLTIYHIKSHLQKYRL 319
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.818262322IPR017930Myb domain
SuperFamilySSF466891.97E-17263319IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-31264320IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-25265320IPR006447Myb domain, plants
PfamPF002494.0E-9267318IPR001005SANT/Myb domain
PfamPF143796.3E-22353399IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MSTQSVIAVK QFSGPDKIAQ AYTVPQPSAH VLSNANYDYD LCGSTNSTSL SCAIQSSNIK  60
TESISSSSLP KILPFSTDSN GESSLSRMSQ AEFSDPILSS SSTFCTSLYT SSPMNSGSCR  120
KTGYLPFLPQ PPKCEQQQNS AGQSSSSLML LDADLRNSGH ADDEHTDDLK DFLNLSSDCS  180
FHGKCSAMAY NEQMEFQFLS EQLGIAISNN EESPRLDDIY DRPPQLMSLP VSSCSDQEDL  240
QDARSPAKVQ LSSSRSSSGT ASCNKPRLRW TPELHERFVD AVNKLEGPEK ATPKGVLKLM  300
KVEGLTIYHI KSHLQKYRLA KYLPETKEDK KQEEKKTKSV ANGNDHAKKK SAQMAEALRM  360
QMEVQKQLHE QLEVQRQLQL RIEEHARYLQ KILEEQQKAR ESISSMTSTT EGESPEFAPM  420
EKTEDKAETS SAPLSKCRIT DTDAECHSKV DNKKTKPQAD LEMVHDE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.522190.0callus| flower| leaf| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329757220.0
Expression AtlasQ6YXZ4-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout all stages of plant growth. Increased expression in leaves before the booting stage. {ECO:0000269|PubMed:26082401}.
UniprotTISSUE SPECIFICITY: Expressed in the root cap and in the exodermis of the root, in the root tip of lateral roots, in the mesophyll cells of the leaf, in pollen, vascular cylinder of the anther and the veins of the lemma, palea and pistils, and in the xylem and phloem regions of large vascular bundles, small vascular bundles and diffuse vascular bundles in node I (PubMed:26082401). {ECO:0000269|PubMed:26082401}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR1 and PHR2 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:26082401}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g04640.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated under Pi starvation conditions. {ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g04640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0657040.0AK065704.1 Oryza sativa Japonica Group cDNA clone:J013037C19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627390.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015627391.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLQ6YXZ40.0Q6YXZ4_ORYSJ; Os02g0139000 protein
STRINGLOC_Os02g04640.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-65G2-like family protein
Publications ? help Back to Top
  1. Guo M, et al.
    Integrative Comparison of the Role of the PHOSPHATE RESPONSE1 Subfamily in Phosphate Signaling and Homeostasis in Rice.
    Plant Physiol., 2015. 168(4): p. 1762-76
    [PMID:26082401]