PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g04340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 670aa    MW: 70271.1 Da    PI: 5.0054
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g04340.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK231.6e-07486515130
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclT 30 
                       aek+++le+l+k+Fs+++kdAA++Lg + +
  LOC_Os02g04340.1 486 AEKSVTLEELQKHFSGSLKDAARSLGAGYS 515
                       5899**********************8865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF542772.98E-18554628No hitNo description
PROSITE profilePS5174515.469561657IPR000270PB1 domain
SMARTSM006667.0E-17561657IPR000270PB1 domain
PfamPF005643.5E-11562634IPR000270PB1 domain
CDDcd064072.24E-30562644No hitNo description
Gene3DG3DSA:3.10.20.2409.2E-22562628No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MERVVGDFNL LLQRGGAAGE RGSEGGGGGS PGTEEAAAVA VKQRIARALR LYKEAAGDGG  60
GGWMVQVWAP ARDGARRVLA TRGQPFVLAS QCHRLFQYRT VSLTRVFPVG GAAAADEQGL  120
PARAFDATAP EWTPNVQCYG SGEYARISYA LIYDIQGSLA LPILDPDDAS SPLAVLELVT  180
TAPLLRVSGE VANLCNALRA VSLRGAGICN RAAECYSLAV NQIVHRDATR AAMAEVSELL  240
ITVCEAHKLP LAQTWVRCWS CGGGGEDTEK AALTTAGAPF HLAAGADARG FRDACVEHHL  300
QRGQGLVGTA ARAPGGGRLC ADVARCSKDD YPLAHYAGMY GLAGCLVLRA ELSAAAMADA  360
AAATAGDEED CVVLELFLPP DCTGVAEQKA AVDAVSATIK QCSGNLKAIV ISNLDDLFLD  420
TMADGDHQLR HEMDDLGDDQ RCSDEEDLQL LENTNIGELN IHNADQIRNE DPTSQVGKNK  480
TKRGKAEKSV TLEELQKHFS GSLKDAARSL GAGYSVDYLH QNPDVYAQIN TQPLKVGSPG  540
SMASQGGHFA RSARCGNGDG VVTIKASHRG DIIRFRVPCS AGVAAVKAVV AKRLSLDAGA  600
FDVKYLDDDH EWVLLSCDAD FQECLDVVPA LPSMSVTARS GSGAAAPVVV RLMVQEVADN  660
IGSSCASSD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.797980.0leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2975985470.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g04340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g04340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0054740.0AP005474.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0081C13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627710.10.0PREDICTED: protein NLP3-like
TrEMBLA0A0E0G0T50.0A0A0E0G0T5_ORYNI; Uncharacterized protein
STRINGLOC_Os02g04340.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
MonocotsOGMP62692939
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.12e-81Nin-like family protein