PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g02370.1
Common NameLOC4328065, Os02g0114800, OsJ_05107, P0036E06.19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 298aa    MW: 32118.7 Da    PI: 8.07
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g02370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl
  LOC_Os02g02370.1 15 KGLWSPEEDQRLRDYIVKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 62
                      678*******************************************97 PP

2Myb_DNA-binding52.98.5e-1768113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg +++eE+++ +++ ++lG++ W+ Ia +++ gRt++++k++w++yl
  LOC_Os02g02370.1  68 RGMFSQEEEDIVINLQAKLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 113
                       788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7851062IPR017930Myb domain
SuperFamilySSF466893.52E-2912109IPR009057Homeodomain-like
SMARTSM007177.8E-121464IPR001005SANT/Myb domain
PfamPF002491.9E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-221669IPR009057Homeodomain-like
CDDcd001675.22E-111862No hitNo description
PROSITE profilePS5129425.6963117IPR017930Myb domain
SMARTSM007172.2E-1567115IPR001005SANT/Myb domain
PfamPF002494.5E-1568113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2570117IPR009057Homeodomain-like
CDDcd001677.68E-1371113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGCRSCDKPK MNYRKGLWSP EEDQRLRDYI VKHGLGCWSA VPAKAGLQRN GKSCRLRWIN  60
YLRPGLKRGM FSQEEEDIVI NLQAKLGNKW SQIAMHLPGR TDNEVKNYWN SYLKKRVMQA  120
QGSIPNNLAA AAAEVTSMST TEPPSLHHHH HHPHHHQIKN SSGSTTTSHD QDANLSSGGS  180
HGGISAPAPV AEPFDQQPKS FVFTGDWMPM SAAAAGQESY SISAQHWPAS TASSGNVTPS  240
HGGAFGDQMS GSYGALQQQH QSSAAAAPMA GGGGYFDLLN MGDIYGGFAA TSDDLLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-25911723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154437820.0
Expression AtlasQ6Z7B6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g02370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g02370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0048670.0AP004867.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0036E06.
GenBankAP0040900.0AP004090.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1399_H05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624260.10.0PREDICTED: transcription factor MYB24
SwissprotQ8LPH68e-55MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0E0N8U30.0A0A0E0N8U3_ORYRU; Uncharacterized protein
TrEMBLQ6Z7B60.0Q6Z7B6_ORYSJ; Os02g0114800 protein
STRINGLOC_Os02g02370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP122962735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.14e-57myb domain protein 86