PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g01380.1
Common NameOs02g0104500, OSNPB_020104500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 371aa    MW: 40503.2 Da    PI: 5.1785
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g01380.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix1024.5e-32184268186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW+k+ev aLi++r+ +e+r+++  lk+plWeevs++m++ g++r++k+Ckekwen+nk+++k ke+ kkr + + +tcpyfd+l+
  LOC_Os02g01380.1 184 RWPKHEVEALIRVRTGLEDRFQEPGLKGPLWEEVSARMAAAGYRRNAKRCKEKWENINKYFRKAKESGKKR-PAHAKTCPYFDELD 268
                       8********************************************************************98.99999*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.073177241IPR017877Myb-like domain
CDDcd122035.39E-30183248No hitNo description
PfamPF138371.3E-23183270No hitNo description
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MLAPPMADLP DAAAANPPHL NTSETSAGED AHAVVQPQPQ TQQPSGADAA RRKRKRRRQE  60
QLSASASFFE RLVQRLMEHQ ESLHRQFLDT MERRERERAA RDEAWRRQEA DKFAREAAAR  120
AQDRASAAAR ESAIIAYLEK ISGETITLPP PAANPAPGAD EQDGVGKEVV AYDGEGSLQL  180
SSSRWPKHEV EALIRVRTGL EDRFQEPGLK GPLWEEVSAR MAAAGYRRNA KRCKEKWENI  240
NKYFRKAKES GKKRPAHAKT CPYFDELDRL YSRSGSGGGG GSSSAGGNGG EEAKGSSELL  300
DAVVKYPDVR CAPPGFPFDG EQNEEGRTKD DGDEAHHDGD GDGDEEDVGV GVGRATDDHD  360
DQVDESHDGH *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15055RRKRKR
25156RKRKRR
35157RKRKRRR
45257KRKRRR
55357RKRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.107970.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379896860.0
Expression AtlasA0A0P0VDM9-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g01380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g01380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0067200.0AP006720.1 Oryza sativa Japonica Group genomic DNA, chromosome 2, clone:OJA1212_C06.
GenBankAP0040490.0AP004049.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1212_C06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622863.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLA0A0P0VDM90.0A0A0P0VDM9_ORYSJ; Os02g0104500 protein (Fragment)
TrEMBLQ6YPG70.0Q6YPG7_ORYSJ; Os02g0104500 protein
STRINGLOC_Os02g01380.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
MonocotsOGMP63993547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.23e-41Trihelix family protein