PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g74590.1
Common NameLOC4327813, Os01g0977300, OsJ_04971, OSNPB_010977300, P0020E09.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 251aa    MW: 27339.3 Da    PI: 10.5197
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g74590.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.2e-161055147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W +eEd ll ++v+q+G+++W+ I+  ++ gR++k+c++rw + 
  LOC_Os01g74590.1 10 KGSWRAEEDALLTRLVAQHGPHRWSIISGAIP-GRSGKSCRLRWCNQ 55
                      799*****************************.***********985 PP

2Myb_DNA-binding60.14.9e-1964106347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T++Ed ll+ a++++G++ W+tIar ++ gRt++++k++w++ 
  LOC_Os01g74590.1  64 PFTPQEDALLAAAHARHGNK-WATIARLLP-GRTDNSVKNHWNSN 106
                       89******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.919560IPR017930Myb domain
SuperFamilySSF466894.87E-298103IPR009057Homeodomain-like
SMARTSM007171.1E-14958IPR001005SANT/Myb domain
PfamPF002495.1E-151055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-211161IPR009057Homeodomain-like
CDDcd001675.52E-131254No hitNo description
SMARTSM007171.2E-1561109IPR001005SANT/Myb domain
PROSITE profilePS5129419.91461111IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-2362109IPR009057Homeodomain-like
PfamPF002491.5E-1664106IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGMCSKTRKK GSWRAEEDAL LTRLVAQHGP HRWSIISGAI PGRSGKSCRL RWCNQLSPAV  60
QHRPFTPQED ALLAAAHARH GNKWATIARL LPGRTDNSVK NHWNSNLRRC LRRQAKFKSK  120
DPDLLPDPIN IPPDCIVVLN DDDEPADRPV TPPAIIQAQA QETLPSLTLS LSLSLPGAAA  180
AAAEVEVAPP PPRALAAASE IQDGSSRSSS ASRVMLQVMR QMVREEVQRH TAQLAYSLMA  240
LASCSRRPPN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-36101094103C-Myb DNA-Binding Domain
1mse_C6e-36101094103C-Myb DNA-Binding Domain
1gv2_A6e-36101094103MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-351010958157MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-351010958157MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.162030.0panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329958400.0
Expression AtlasQ84SF0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g74590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g74590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032280.0AP003228.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0020E09.
GenBankAK1106310.0AK110631.1 Oryza sativa Japonica Group cDNA clone:002-169-B11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644045.10.0PREDICTED: transcription factor MYB44
TrEMBLA0A0D3EZD10.0A0A0D3EZD1_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9YKV10.0A0A0D9YKV1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0N8C40.0A0A0E0N8C4_ORYRU; Uncharacterized protein
TrEMBLI1NVS30.0I1NVS3_ORYGL; Uncharacterized protein
TrEMBLQ84SF00.0Q84SF0_ORYSJ; Os01g0977300 protein
STRINGLOC_Os01g74590.10.0(Oryza sativa Japonica Group)
STRINGORGLA01G0396300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP135442731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-48myb domain protein 77