PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g74440.1
Common NameLOC107275406, Os01g0975800, OsJ_04958, OSNPB_010975800, P0459B04.28
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 209aa    MW: 22916.3 Da    PI: 10.7204
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g74440.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.31.5e-212471249
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                      rie++  rqv fskRr+g +KKA+ELS+LC a+va ++fs+ gk y +
  LOC_Os01g74440.1 24 RIESEEARQVCFSKRRAGFFKKASELSILCSADVAAVVFSPAGKAYSF 71
                      8*******************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.83E-261585IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.1561575IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-301574IPR002100Transcription factor, MADS-box
CDDcd002651.10E-391691No hitNo description
PRINTSPR004043.3E-201737IPR002100Transcription factor, MADS-box
PfamPF003193.2E-252471IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-203752IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-205273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MAMQVAAPSR RRPSLGRQKI EIRRIESEEA RQVCFSKRRA GFFKKASELS ILCSADVAAV  60
VFSPAGKAYS FGHPSVECLL ERFLPDSSSG AAARVRRGAN NNGGGGMVGE LNRQYGELRA  120
MVEAHKARRE RADEKIEMER AAGRWLPMDA DVRRMSPEEL MAFGTGLMAV QAAVSARADQ  180
MLRDALLIGR RPPTTTTAGF GFFHMPHY*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ94CT0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g74440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g74440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0036270.0AP003627.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0459B04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640475.11e-151PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLA0A0D3EZB41e-151A0A0D3EZB4_9ORYZ; Uncharacterized protein
TrEMBLA2WZN31e-151A2WZN3_ORYSI; Putative uncharacterized protein
TrEMBLI1NVQ91e-151I1NVQ9_ORYGL; Uncharacterized protein
TrEMBLQ94CT01e-151Q94CT0_ORYSJ; MADS-box protein-like
STRINGBGIOSGA005284-PA1e-150(Oryza sativa Indica Group)
STRINGLOC_Os01g74440.11e-150(Oryza sativa Japonica Group)
STRINGORGLA01G0394900.11e-150(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-26AGAMOUS-like 62