PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g74410.2
Common NameOs01g0975300, OSNPB_010975300, P0459B04.21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 211aa    MW: 24075.6 Da    PI: 6.7855
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g74410.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-184590148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rgr+++eE+   v+++++lG++ W++Ia+ ++ gRt++++k++w+++l
  LOC_Os01g74410.2 45 RGRMSPEEERMVVQLHAKLGNR-WSRIAKSIP-GRTDNEIKNYWRTHL 90
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.8441739IPR017877Myb-like domain
SuperFamilySSF466891.18E-212298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-92552IPR009057Homeodomain-like
PROSITE profilePS5129426.3334094IPR017930Myb domain
SMARTSM007172.8E-174492IPR001005SANT/Myb domain
PfamPF002492.1E-164590IPR001005SANT/Myb domain
CDDcd001675.58E-134790No hitNo description
Gene3DG3DSA:1.10.10.602.4E-215391IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MRAINAGCWI VRRVYGWCVA DAGLQRSGKS CRLRWVNYLH PGLKRGRMSP EEERMVVQLH  60
AKLGNRWSRI AKSIPGRTDN EIKNYWRTHL RKLKLKQQKQ QQSDDHHNDN DDDDDRNSSS  120
SSSSSNSNSN LQQQPQPEDE SSASGSLQAQ HHEDQHQLFL HPLWNDDIIV DVDCWSSSTN  180
VVAPPPMPAS PLWDIDDAFF CSDYSLPLWG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-19159222103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.4080.0callus| leaf| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO525507740.0
Expression AtlasQ5JL15-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g74410.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g74410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5696150.0AY569615.1 Oryza sativa (japonica cultivar-group) MYB transcription factor (Myb) precursor RNA, complete cds.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0036270.0AP003627.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0459B04.
GenBankAK0661800.0AK066180.1 Oryza sativa Japonica Group cDNA clone:J013058H19, full insert sequence.
GenBankAK0618230.0AK061823.1 Oryza sativa Japonica Group cDNA clone:001-040-C01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621159.11e-103PREDICTED: transcription factor MYB59
SwissprotQ4JL845e-39MYB59_ARATH; Transcription factor MYB59
TrEMBLQ5JL151e-155Q5JL15_ORYSJ; Os01g0975300 protein
STRINGLOC_Os01g74410.11e-103(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.33e-37myb domain protein 59