PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g74410.1
Common NameLOC4324302, Myb, OsJ_04957
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 277aa    MW: 31029.4 Da    PI: 7.3969
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g74410.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.5e-1458105148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT++Ed +lv  v++lG ++W+  a+  g+ R++k+c++rw +yl
  LOC_Os01g74410.1  58 KGPWTEQEDVQLVWFVRLLGERRWDFLAKVSGLQRSGKSCRLRWVNYL 105
                       79********************************************97 PP

2Myb_DNA-binding56.56.6e-18111156148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rgr+++eE+   v+++++lG++ W++Ia+ ++ gRt++++k++w+++l
  LOC_Os01g74410.1 111 RGRMSPEEERMVVQLHAKLGNR-WSRIAKSIP-GRTDNEIKNYWRTHL 156
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576125No hitNo description
PROSITE profilePS5129412.98253105IPR017930Myb domain
SuperFamilySSF466893.15E-2757152IPR009057Homeodomain-like
SMARTSM007177.3E-1157107IPR001005SANT/Myb domain
PfamPF002491.8E-1258105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-1759112IPR009057Homeodomain-like
CDDcd001671.62E-860105No hitNo description
PROSITE profilePS5129426.333106160IPR017930Myb domain
SMARTSM007172.8E-17110158IPR001005SANT/Myb domain
PfamPF002493.3E-16111156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-24113158IPR009057Homeodomain-like
CDDcd001672.06E-12113156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MVVAGKKQGR HSFSASSSSS SSSSCSVVQL GHHQRPQGED PLIGIKAAAA GGGGIMRKGP  60
WTEQEDVQLV WFVRLLGERR WDFLAKVSGL QRSGKSCRLR WVNYLHPGLK RGRMSPEEER  120
MVVQLHAKLG NRWSRIAKSI PGRTDNEIKN YWRTHLRKLK LKQQKQQQSD DHHNDNDDDD  180
DRNSSSSSSS SNSNSNLQQQ PQPEDESSAS GSLQAQHHED QHQLFLHPLW NDDIIVDVDC  240
WSSSTNVVAP PPMPASPLWD IDDAFFCSDY SLPLWG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C9e-27551581103C-Myb DNA-Binding Domain
1mse_C9e-27551581103C-Myb DNA-Binding Domain
1gv2_A1e-26581584103MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-265815858157MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-265815858157MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.4080.0callus| leaf| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO525507740.0
Expression AtlasQ56UT4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g74410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g74410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3985810.0AY398581.1 Oryza sativa (indica cultivar-group) Myb factor protein (Myb) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621159.10.0PREDICTED: transcription factor MYB59
TrEMBLA0A0E0N8A10.0A0A0E0N8A1_ORYRU; Uncharacterized protein
TrEMBLQ56UT40.0Q56UT4_ORYSJ; MYB transcription factor
STRINGLOC_Os01g74410.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.33e-56myb domain protein 59