PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g74140.1
Common NameLOC4326396, Os01g0972800, OsJ_04935, OSNPB_010972800, P0518C01.36, P0698H10.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 411aa    MW: 45109.9 Da    PI: 4.6849
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g74140.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.83.5e-31160216258
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                       dDgy+WrKYGqK++k+s++prsYYrCt ++C++kk+ver+ ++p+++++tYeg H h
  LOC_Os01g74140.1 160 DDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCNAKKQVERAVDEPDTLIVTYEGLHLH 216
                       8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.164154219IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.4E-29157217IPR003657WRKY domain
SuperFamilySSF1182903.53E-26158217IPR003657WRKY domain
SMARTSM007747.5E-36159218IPR003657WRKY domain
PfamPF031065.4E-25160216IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MDGAMQESRE YWRDGGDVVG EELLREILDE TAAVHSNSNS NSNSNSNSKE AEEEDEREYF  60
AAAAADEQLQ VEAPCGRRRR ESMVNKLIST VYSGPTISDI ESALSFTAAG DHQLLADGHN  120
FAASSCSPVV FSPEKTLSKT MENKYTLKMK SCGNNGGLAD DGYKWRKYGQ KSIKNSPNPR  180
SYYRCTNPRC NAKKQVERAV DEPDTLIVTY EGLHLHYTYS HFLHSTSSSS SSTTTQQQLQ  240
PQPQMMTNCK KKPKLHLHPL LHDDPPPPPP PPEMTTMMIM QSFSIQQQQH DDDQLLQPAA  300
DDHLMVQAPP DDCYNINGSS SSGLMMSLDD DEQAAGAGGL LEDVVPLLVR RPPPPICNNN  360
NYYYSPATTC TSDNEYGSSA SASPSSSVSV SSWTTPMSPC IDMAILSNIF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-211582161674Probable WRKY transcription factor 4
2lex_A9e-211582161674Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335191710.0
Expression AtlasQ5JM93-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g74140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g74140
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8706050.0AY870605.1 Oryza sativa (japonica cultivar-group) WRKY17 mRNA, complete cds.
GenBankAY3418420.0AY341842.1 Oryza sativa (japonica cultivar-group) WRKY1 mRNA, complete cds.
GenBankAK1106250.0AK110625.1 Oryza sativa Japonica Group cDNA clone:002-169-B02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641374.10.0PREDICTED: probable WRKY transcription factor 49
TrEMBLA0A0E0N8740.0A0A0E0N874_ORYRU; Uncharacterized protein
TrEMBLQ5JM930.0Q5JM93_ORYSJ; Os01g0972800 protein
STRINGLOC_Os01g74140.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP75253551
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.19e-41WRKY DNA-binding protein 49