PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g74020.1
Common NameLOC4326391, Os01g0971800, OsJ_04927, P0518C01.17, PCL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 239aa    MW: 25617.3 Da    PI: 7.0109
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g74020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.39.6e-30119171255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       +rl+Wtp+LH+rFve+v++L G ++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  LOC_Os01g74020.1 119 ARLVWTPQLHKRFVEVVAHL-GMKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 171
                       79******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.54115174IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-30115176IPR009057Homeodomain-like
SuperFamilySSF466893.94E-19116175IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23119171IPR006447Myb domain, plants
PfamPF002492.2E-9121170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGEEAPEEYE LGGGEDERVM EWETGLPGAD ELTPLSQPLV PAGLAAAFRI PPEPGRTLLD  60
VHRASAATVS RLRRASSSSS SSFPAFASKG AGTGADEAES GGGADGGNGN TNNSSSKRAR  120
LVWTPQLHKR FVEVVAHLGM KNAVPKTIMQ LMNVEGLTRE NVASHLQKYR LYVKRMQGLS  180
NEGPSPSDHI FASTPVPHAS LHDQVPSPYH PHPHHHSYNN AAYAATVSSY HHYHHANH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-19114176163ARR10-B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO463718690.0
Expression AtlasQ94DH3-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g74020.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g74020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032770.0AP003277.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0518C01.
GenBankAB2065780.0AB206578.1 Oryza sativa Japonica Group OsPCL1 gene for putative transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640779.11e-175PREDICTED: transcription factor PCL1
SwissprotQ94DH31e-177PCL1_ORYSJ; Transcription factor PCL1
TrEMBLA0A0D3EZ771e-173A0A0D3EZ77_9ORYZ; Uncharacterized protein
TrEMBLI1NVN11e-173I1NVN1_ORYGL; Uncharacterized protein
STRINGLOC_Os01g74020.11e-175(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11571753
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.32e-48G2-like family protein
Publications ? help Back to Top
  1. Onai K,Ishiura M
    PHYTOCLOCK 1 encoding a novel GARP protein essential for the Arabidopsis circadian clock.
    Genes Cells, 2005. 10(10): p. 963-72
    [PMID:16164597]