PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g72490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SRS
Protein Properties Length: 341aa    MW: 34771.2 Da    PI: 7.627
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g72490.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.23.5e-711112694154
            DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 
                       g+a+CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaa+rrerqq + +ass+ a+++a+aask++r l  ++q+++s+t++s+a++
  LOC_Os01g72490.1 111 GAATCQDCGNQAKKDCGHQRCRTCCKSRGFDCSTHVKSTWVPAARRRERQQLTGSASSSPATASAAAASKKPRLL--TSQTTTSHTSTSNATT 201
                       6789*********************************************************************87..88999999******** PP

            DUF702  97 kkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                       +++++t+s          lP++v+++avfrcvrv+s+ddge+e+aYq++v+i+GhvfkG+LydqG+++
  LOC_Os01g72490.1 202 PRSFDTTSshqdasfresLPRQVRAPAVFRCVRVTSIDDGEDEYAYQATVTINGHVFKGFLYDQGVDD 269
                       *****99999*******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.6E-63112268IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.8E-27114156IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.7E-29220267IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MADVGMVVVT PAASFHHTHH HHHHHEAAAA AAAAAAAAAD PIFPLLSAGP CVLDPDKSAA  60
SGSAIQFWQP PPQLPSSAAG GNPNPSSSAF PYLKKPLPML DTGGGSSGSG GAATCQDCGN  120
QAKKDCGHQR CRTCCKSRGF DCSTHVKSTW VPAARRRERQ QLTGSASSSP ATASAAAASK  180
KPRLLTSQTT TSHTSTSNAT TPRSFDTTSS HQDASFRESL PRQVRAPAVF RCVRVTSIDD  240
GEDEYAYQAT VTINGHVFKG FLYDQGVDDG RGLAATSNDD STAGGVPNIS ELHLGGASIS  300
GNAMREGGSS MVHSDLYGGG GGSGGGPHIL GGSSYGNTMN *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.93550.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329876530.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g72490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g72490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1024440.0AK102444.1 Oryza sativa Japonica Group cDNA clone:J033093N15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622050.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ94CK91e-67LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLB8A9L50.0B8A9L5_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA000090-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13131549
MonocotsOGMP35793679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.23e-61Lateral root primordium (LRP) protein-related