PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g72370.1
Common NameLOC4325750, OsJ_04787, P0431G06.13-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bHLH
Protein Properties Length: 249aa    MW: 27089.7 Da    PI: 6.0338
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g72370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH44.33.3e-1469121155
                       CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
               HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                       r+ +hn+ Er RR+++N+ ++ Lr llP a   + kKls  +++ ++ +YI +Lq
  LOC_Os01g72370.1  69 RKLSHNAYERDRRKQLNELYSSLRALLPDA--DHTKKLSIPTTVSRVLKYIPELQ 121
                       6889*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474593.53E-1666136IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.95468120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.35E-1268125No hitNo description
Gene3DG3DSA:4.10.280.108.4E-1369136IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.0E-1169121IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003538.4E-1074126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0090575Cellular ComponentRNA polymerase II transcription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MEQLFVDDPA FASSMSSLEA DIFSGAGQLP SSPWLDLDLD DDVQDLSMAP TTANAVSSGY  60
GSGGSGSHRK LSHNAYERDR RKQLNELYSS LRALLPDADH TKKLSIPTTV SRVLKYIPEL  120
QKQVENLERK KKELTTTSTT NCKPGVLGSQ LMSEGMAPIV SATCINDMEI MVQVSLLSNV  180
AGSVLPLSKC IKVLENEGLH FISSSTSSGF GNRTFYSIHL QRSEGTINEE CPAFCERLEK  240
VVRNKAKL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.218930.0callus| leaf| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329834080.0
Expression AtlasQ941Z7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g72370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g72370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0733850.0AK073385.1 Oryza sativa Japonica Group cDNA clone:J033041D19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612709.10.0PREDICTED: transcription factor bHLH100
TrEMBLA0A0D3EYS00.0A0A0D3EYS0_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9YK460.0A0A0D9YK46_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CD210.0A0A0E0CD21_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FYV70.0A0A0E0FYV7_ORYNI; Uncharacterized protein
TrEMBLA2WZ600.0A2WZ60_ORYSI; Putative uncharacterized protein
TrEMBLI1NVB20.0I1NVB2_ORYGL; Uncharacterized protein
TrEMBLQ941Z70.0Q941Z7_ORYSJ; BHLH transcription factor-like
STRINGLOC_Os01g72370.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA000097-PA0.0(Oryza sativa Indica Group)
STRINGORGLA01G0380200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28261129
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.12e-32bHLH family protein
Publications ? help Back to Top
  1. Ogo Y, et al.
    Isolation and characterization of IRO2, a novel iron-regulated bHLH transcription factor in graminaceous plants.
    J. Exp. Bot., 2006. 57(11): p. 2867-78
    [PMID:16887895]