PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g70890.1
Common NameLOC9266773, Os01g0935200, OsHAP3D, OsJ_04677, OSNPB_010935200, P0423A12.45, P0492G09.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 178aa    MW: 19205.3 Da    PI: 6.7182
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g70890.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.98.4e-5533128297
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ yl+kyrele
  LOC_Os01g70890.1  33 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRRYLNKYRELE 125
                       89******************************************************************************************* PP

             NF-YB  95 gek 97 
                       g++
  LOC_Os01g70890.1 126 GDR 128
                       *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.8E-5127139IPR009072Histone-fold
SuperFamilySSF471131.09E-3835132IPR009072Histone-fold
PfamPF008085.3E-2738101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-176684No hitNo description
PROSITE patternPS0068506985IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-1785103No hitNo description
PRINTSPR006151.7E-17104122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001059developmental stageJ bicellular pollen stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MADHHGGHHA DGHRRQQQLQ GEAADQAAAE IIKEQDRLLP IANVGRIMKQ ILPPNAKISK  60
EAKETMQECV SEFISFVTGE ASDKCHKEKR KTVNGDDVCW AFGALGFDDY VDPMRRYLNK  120
YRELEGDRAA AAATSRSGAG AAAGPDHPSS SSSAAAATAG HFMFNAMDRS TDSSRQF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-4432123192Transcription factor HapC (Eurofung)
4g92_B7e-4432123192Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166406310.0
Expression AtlasQ942Y5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g70890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g70890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032660.0AP003266.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0492G09.
GenBankAP0032460.0AP003246.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423A12.
GenBankAB2880380.0AB288038.1 Oryza sativa Japonica Group OsHAP3D gene for HAP3 subunit of HAP complex, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635864.11e-131PREDICTED: nuclear transcription factor Y subunit B-1
RefseqXP_015635872.11e-131PREDICTED: nuclear transcription factor Y subunit B-1
SwissprotO822487e-58NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0E0N7B51e-130A0A0E0N7B5_ORYRU; Uncharacterized protein
TrEMBLQ942Y51e-130Q942Y5_ORYSJ; HAP3 subunit of HAP complex
STRINGLOC_Os01g70890.11e-130(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.18e-58nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]