PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g70880.1
Common NameOs01g0935100, OSNPB_010935100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 145aa    MW: 15592.4 Da    PI: 8.8824
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g70880.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB144.72.1e-45495394
             NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                       qd++lPianv+rimk  lP +akisk aket+qec++efisfvt+eas++c+re+rkt+ngdd+++a+ +lG+++y+++++ yl++yre e
  LOC_Os01g70880.1  4 GQDNLLPIANVGRIMKDGLPPQAKISKRAKETIQECATEFISFVTGEASERCRRERRKTVNGDDVCHAMRSLGLDHYADAMHRYLQRYREGE 95
                      69***************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.9E-423100IPR009072Histone-fold
SuperFamilySSF471137.61E-345107IPR009072Histone-fold
PfamPF008082.5E-24972IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-143654No hitNo description
PROSITE patternPS0068503955IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.2E-145573No hitNo description
PRINTSPR006152.2E-147492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MTNGQDNLLP IANVGRIMKD GLPPQAKISK RAKETIQECA TEFISFVTGE ASERCRRERR  60
KTVNGDDVCH AMRSLGLDHY ADAMHRYLQR YREGEELAAS LNSSSSAAAA AAAAGSRGGG  120
AIQIDVRAEL SIFRSGNNQG RPNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B5e-39593492Transcription factor HapC (Eurofung)
4g91_B5e-39593492Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0VCF9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g70880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g70880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032660.0AP003266.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0492G09.
GenBankAP0032460.0AP003246.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423A12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690868.14e-81PREDICTED: transcriptional activator hap3-like
SwissprotO040276e-44NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A0P0VCF91e-103A0A0P0VCF9_ORYSJ; Os01g0935100 protein
STRINGLOC_Os01g70880.11e-103(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.12e-44nuclear factor Y, subunit B4