PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g70810.1
Common NameLOC9267191, P0423A12.33-1, P0492G09.3-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HB-other
Protein Properties Length: 1169aa    MW: 128083 Da    PI: 8.4982
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g70810.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.34.6e-0774130157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++R  ++++ ++ +++lF+++ ++ ++e +e++++ g+t +qV+ +F  +R++ +k
  LOC_Os01g70810.1  74 KKPRDLLNPKAVKSMQSLFAMKDTIGKKETREISASFGVTVTQVREFFASQRTRVRK 130
                       799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.71871131IPR001356Homeobox domain
SMARTSM003890.002873135IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.0E-574137IPR009057Homeodomain-like
PfamPF000461.4E-474130IPR001356Homeobox domain
CDDcd000863.57E-474130No hitNo description
SuperFamilySSF466898.13E-674133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1169 aa     Download sequence    Send to blast
MELVPFKPEA GALVESGGGA HGDSIPAMVA AQQELLHAQV DQLQLLVVAQ CRLTGVNPLA  60
QEMAAGALSI KIGKKPRDLL NPKAVKSMQS LFAMKDTIGK KETREISASF GVTVTQVREF  120
FASQRTRVRK FVRLSREKAL RIESSKAPDN VCSISTEQTP VDIEAHAQVI EPLRTLEPLE  180
AQQISLPHLV VPQISLQLPV VLQSCAIPVA PIGVMQPTEA KTNPDPIQKE TKQEEVAGVE  240
SEDKKFLESI FVLMRKENTF SGQVKLMESI LQINNVTVLS WFLTMGGLAI VSTWLGQAVT  300
EEQTTVILVV FKVLLHLPLH KALPAHMSTV LQTINRLRFY RTQDISSKAR NLLSRLSKVL  360
VRSQALKKSQ KDLICKQRIS EILRDESWKS EVDITEDILA LTDDASESRM PEPRKTPLLL  420
TASADESNKK SSLQTKSKEK RKVLLVEHPN RKAAGKNVNP VRSTSTNNSR PLSADDIQKA  480
KMRAMFMQEK YGKVDTSKVI EKPHMMEIQK PSGLVDSNVP LVPRTPLTSI IKQPVDPSPS  540
TSKQSTLSPP DKPEIAVSLK LNVTAKENFI EKLDSKRVIW QIPPEVWIDP AWSLGAGENS  600
KEFEVQTQRN RREKETFYAS LKDIPLNPKG PWDVEMDFDD SLTPEIPIEQ PPDADAMETD  660
SVSTAPPNIV VPVVDKQIGS TSSVSPAVAA GANGATSEPD LELLAVLLKN PQLVFALTSN  720
QGGTLPSEQT VALLDMLKQT GLGLSELVNS LANNSGVQKE PESGPEAIPA SLPSPTPPKD  780
LIARDGWSSE FPSQVRTQNL QHAHLPNRAN APPVASSVQQ SFSNVVSSLP SQPYASASAL  840
PAQTRTNMTS LPQSMISVNP STQHVAPMNN LLSRATVHQH TQSYALTSDP VAVAVHHQPA  900
VNKLAHEVQS ISHPAVSHSS VAESHASYTS YTWQSSVATI AATGRNATPD RWAAPARTTN  960
SFNAAPSNSN HVTYPNQNAY SNHSTQATTY NSYGSAPVSS HSLHPGQGLD RNGYTHAAEY  1020
QTTMARDALW RNSRSPELGA GAVYGSSSQG YVPEPSRQWN YGQQSYNPEP YSRQWSSGQQ  1080
SYNTVTAEPS RQWSSGQQSY SNPAEPSRQW SSSAHAQPSY NPEPSRPWNS GHQSQNPEAS  1140
RQWSHHHGKQ ERYNPTDGRN SYDQHWRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.183650.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329767160.0
Expression AtlasQ942Z1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g70810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g70810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0666980.0AK066698.1 Oryza sativa Japonica Group cDNA clone:J013073H18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620702.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
TrEMBLQ942Z10.0Q942Z1_ORYSJ; Putative flowering-time protein
STRINGLOC_Os01g70810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP41211315
MonocotsOGMP80433034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-148HB-other family protein