PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g69980.1
Common NameB1033B05.8, LOC4327261, Os01g0924400, OsJ_04599, OSNPB_010924400, P0592G05.32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TCP
Protein Properties Length: 282aa    MW: 29072.5 Da    PI: 9.2792
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g69980.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP124.51.2e-3882167388
               TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                       +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t++WLlqqa+pai ++tgt++++as+  +++ s  + ns  +
  LOC_Os01g69980.1  82 PKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETVQWLLQQAEPAIVAATGTGTIPASALASVAPSLPSPNSALS 167
                       6999***********************************************************99999766222222222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.3E-3286172IPR005333Transcription factor, TCP
PROSITE profilePS5136928.03987141IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDPKFPPPPP LNKTEPTTTT TNQQHHHDEQ QQQHRLQIQV HPQQQEQQDG GGGGGKDQQQ  60
QQQMQVVVAA AAGERRMQGL GPKRSSNKDR HTKVDGRGRR IRMPALCAAR IFQLTRELGH  120
KSDGETVQWL LQQAEPAIVA ATGTGTIPAS ALASVAPSLP SPNSALSRSH HHHHHMWAAA  180
PPTASAGFAG AGFSGADSGV IGGIMQRMGI PAGIELQGGG AGGLGGGGGG GGGHIGFAPM  240
FASHAAAAAA MPGLELGLSQ DGHIGVLAAQ SLSQFYHQVV V*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.775340.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329820600.0
Expression AtlasQ5JJP7-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g69980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g69980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0720370.0AK072037.1 Oryza sativa Japonica Group cDNA clone:J013106J07, full insert sequence.
GenBankAP0042230.0AP004223.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1033B05.
GenBankAP0046720.0AP004672.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0592G05.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621786.10.0transcription factor TCP20
SwissprotQ9LSD52e-49TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A0E0N6Z90.0A0A0E0N6Z9_ORYRU; Uncharacterized protein
TrEMBLQ5JJP70.0Q5JJP7_ORYSJ; Os01g0924400 protein
STRINGORUFI01G45710.10.0(Oryza rufipogon)
STRINGOS01T0924400-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Representative plantOGRP9221459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.18e-40TCP family protein
Publications ? help Back to Top
  1. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  2. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  3. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  4. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  5. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  6. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  7. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]