PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g69850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 220aa    MW: 24283.2 Da    PI: 10.4076
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g69850.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.83.8e-2566115251
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                       rie+k  rqv fskRr+g++KKA+EL  LCd+eva+++fs+ gklyeyss
  LOC_Os01g69850.1  66 RIEDKASRQVRFSKRRAGLFKKAFELALLCDVEVALLVFSPVGKLYEYSS 115
                       8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.13257117IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-3157116IPR002100Transcription factor, MADS-box
CDDcd002654.75E-3858134No hitNo description
SuperFamilySSF554553.79E-2959135IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-255979IPR002100Transcription factor, MADS-box
PfamPF003193.0E-2466113IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-257994IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-2594115IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MPPPPPPHSI DPLLLLPHFS PPPHHHTHAR THARLRFPPP TRGGEGGELG FFGAGMARRG  60
RVQLRRIEDK ASRQVRFSKR RAGLFKKAFE LALLCDVEVA LLVFSPVGKL YEYSSSSIEG  120
TYDRYQQFAG ARRDLNEGST SINSDENASI HSRLRDITAW SLQNNADESD ANQLEKLEKL  180
LTNALRDTKS KKMLAKQNGE GSRSRANSSG SRGQEEGSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J4e-1859128271Myocyte-specific enhancer factor 2A
3p57_I4e-1859128271Myocyte-specific enhancer factor 2A
3p57_D4e-1859128271Myocyte-specific enhancer factor 2A
3p57_C4e-1859128271Myocyte-specific enhancer factor 2A
3p57_B4e-1859128271Myocyte-specific enhancer factor 2A
3p57_A4e-1859128271Myocyte-specific enhancer factor 2A
3kov_J4e-1859128271Myocyte-specific enhancer factor 2A
3kov_I4e-1859128271Myocyte-specific enhancer factor 2A
3kov_B4e-1859128271Myocyte-specific enhancer factor 2A
3kov_A4e-1859128271Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.203820.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166363210.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g69850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g69850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0661600.0AK066160.1 Oryza sativa Japonica Group cDNA clone:J013055I02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690798.11e-81PREDICTED: LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL14
TrEMBLA0A0E0FY481e-119A0A0E0FY48_ORYNI; Uncharacterized protein
STRINGLOC_Os01g69850.11e-160(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30260.15e-27AGAMOUS-like 79