PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g68560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 480aa    MW: 51145.5 Da    PI: 4.302
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g68560.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.91.9e-161152344
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
            SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                      i n   r +t+ kR++g++KKA EL +LCd+ vav+ ++++g
  LOC_Os01g68560.1 11 IANPQTRATTYKKRKAGLIKKAGELATLCDIPVAVVCAGPDG 52
                      789999**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-19160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.736152IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-7323IPR002100Transcription factor, MADS-box
CDDcd002661.68E-26381No hitNo description
SuperFamilySSF554555.89E-21383IPR002100Transcription factor, MADS-box
PfamPF003192.6E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MSRRKTSIAL IANPQTRATT YKKRKAGLIK KAGELATLCD IPVAVVCAGP DGGAPTVWVS  60
PEGGDAIERY RALPAEKRAR HTHVAYLQEE LDKERAKLAR LRQKGRPGEL DPPDAVLDGM  120
SQDELQQLLA SIDATLLATA KRREALGLLP GADDDADGGG RRRDADVAGT NSVGVHGYQH  180
QEVHAPATCD PFHPYNAGVT LMQPGYNNAQ YMGGHGAVDM SGYQLQMQMP GNGSNNHSRL  240
AWGGFQPCNA TFVQPVYGNL QCWYNNVVDG NGEPCDAIVP SAGDPYMDIA GNDVYGNQMQ  300
PAPAANGGWH DPGTWGYDGG EPCKAIVPSF GDPYMGIGVY GNQMQPAPAP AANGCWHNPA  360
GTWGNDGEPC NAIVPSAGHP YIDIECDIDG NYIDTTVFDY QTTSTSDNFM DAPVQFIATG  420
SDESIVTNVA GCDETEFSID DLLQCSDASQ HSSGLEELHY LSDLADGFDF GCNFDVLLD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RRKTSIALIANPQTRATTYKKRK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329960370.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g68560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g68560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0034360.0AP003436.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0470A12.
GenBankAP0034330.0AP003433.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0004D12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640115.10.0PREDICTED: uncharacterized protein LOC4324340
TrEMBLA0A0E0N6N90.0A0A0E0N6N9_ORYRU; Uncharacterized protein
STRINGLOC_Os01g68560.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1278735
MonocotsOGMP45722960
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31630.12e-17AGAMOUS-like 86