PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g67770.1
Common NameLOC4325022, ORR6, Os01g0904700, OsJ_04457, OSJNOa013M08.3, RR26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARR-B
Protein Properties Length: 583aa    MW: 64813.5 Da    PI: 4.8449
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g67770.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.78.4e-26192245155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+gLt+e+v+SHLQkYRl
  LOC_Os01g67770.1 192 KARVVWSVDLHQKFVNAVNQI-GFDKVGPKKILDLMNVPGLTRENVASHLQKYRL 245
                       68*******************.9*******************************8 PP

2Response_reg80.55.4e-27121201109
                       EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
      Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealk 91 
                       vl+vdD+p+ +++l+++l+k  y ev+++  ++ al++l+e++  +D+++ D++mp+mdG++ll++i  e  +lp+i+++  ge + + + ++
  LOC_Os01g67770.1  12 VLVVDDDPTWLKILEKMLRKCSY-EVTTCGLARVALDILRERKnkFDIVISDVNMPDMDGFKLLEHIGLEM-DLPVIMMSIDGETSRVMKGVQ 102
                       89*********************.***************877777**********************6654.8******************** PP

                       TTESEEEESS--HHHHHH CS
      Response_reg  92 aGakdflsKpfdpeelvk 109
                        Ga d+l Kp+ ++el++
  LOC_Os01g67770.1 103 HGACDYLLKPVRMKELRN 120
                       ***************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363927.2E-1832575IPR017053Response regulator B-type, plant
SuperFamilySSF521725.98E-359133IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.0E-439146No hitNo description
SMARTSM004481.4E-3110122IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.71811126IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.5E-2412121IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.28E-2913125No hitNo description
SuperFamilySSF466893.49E-18189249IPR009057Homeodomain-like
PROSITE profilePS512949.161189248IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-28191250IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-22192245IPR006447Myb domain, plants
PfamPF002499.1E-8194244IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MDATAFPYGL RVLVVDDDPT WLKILEKMLR KCSYEVTTCG LARVALDILR ERKNKFDIVI  60
SDVNMPDMDG FKLLEHIGLE MDLPVIMMSI DGETSRVMKG VQHGACDYLL KPVRMKELRN  120
IWQHVYRKKM HEVKEIEGND SCDDLQILRN SFEGLDEKSL FMRSDSDTMR KRKDVDKDHA  180
DQESSDGNTV KKARVVWSVD LHQKFVNAVN QIGFDKVGPK KILDLMNVPG LTRENVASHL  240
QKYRLYLSRL QKQNEERILG AARQDFSHKG TSENLNLRSS FQEQPSNIAN GYPHASQNIQ  300
TQANMLDSQL EDTKSTVPLP VPDKKRTLAS DAADSQNVTS ASSLGGVLSF KSMPVNQDRK  360
PSETMILECQ AWTGGIPSKQ FMQYPKHNHE RCDLLGDYSC LPKPDLEHPV GPSNLYAPPP  420
LISMSCGMEG DARDFSDVKP AIMDCIKSLS PALTCTVDSV SVQLSDSVVT SIDGDLKSSG  480
VDGLPSIKDC CLDQTNSQGS LRPSQEPSII GSTELASLPE DLPSYPLHGV SLENIGLSSI  540
DLLNYSDAMI LSGLQSNWYD DLEFSSEMMD YPSIDECLFA SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-18191250463ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.494280.0leaf| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329722680.0
Expression AtlasQ5N6V8-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g67770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Dwarf, narrow leaf, low tillering, late heading and low fertility phenotypes. {ECO:0000269|PubMed:16891544}.
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g67770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0622500.0AK062250.1 Oryza sativa Japonica Group cDNA clone:001-047-G01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622017.10.0PREDICTED: two-component response regulator ORR26
SwissprotQ5N6V80.0ORR26_ORYSJ; Two-component response regulator ORR26
TrEMBLA0A0D3EXJ90.0A0A0D3EXJ9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0N6F70.0A0A0E0N6F7_ORYRU; Uncharacterized protein
TrEMBLI1NUE70.0I1NUE7_ORYGL; Uncharacterized protein
STRINGLOC_Os01g67770.10.0(Oryza sativa Japonica Group)
STRINGORGLA01G0348700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
MonocotsOGMP59003752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-113response regulator 11
Publications ? help Back to Top
  1. Pareek A, et al.
    Whole-genome analysis of Oryza sativa reveals similar architecture of two-component signaling machinery with Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 380-97
    [PMID:16891544]
  2. Ito Y,Kurata N
    Identification and characterization of cytokinin-signalling gene families in rice.
    Gene, 2006. 382: p. 57-65
    [PMID:16919402]
  3. Schaller GE, et al.
    Nomenclature for two-component signaling elements of rice.
    Plant Physiol., 2007. 143(2): p. 555-7
    [PMID:17284581]