PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g67670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 276aa    MW: 30461.6 Da    PI: 6.9434
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g67670.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS209.61.7e-6472274167374
              GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                        +Ae lg+ +ef+  + + le+l++++L v+ +Ea+a+n+vl+lh++++es    +   +vL+++++lsP+ +v+veq+a hn++ Fl rf+e
  LOC_Os01g67670.1  72 AYAEGLGMYLEFRG-INRGLESLHIDDLGVDADEAVAINSVLELHSVVKESRGALN---SVLQTIRKLSPRAFVLVEQDAGHNAPFFLGRFME 160
                       58999*********.799******************************88877777...8********************************* PP

              GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrv 351
                       al+yy+alfd+l+a lpr +  r+ vE++ +g ei+nvv cega+r+erhe++ +Wr+r+++aGF++vp++    ++a+  l + + +dgy+v
  LOC_Os01g67670.1 161 ALHYYAALFDALDAALPRYDARRARVEQFHFGAEIRNVVGCEGAARVERHERADQWRRRMSRAGFQSVPIKMA--AKAREWLDENAgGDGYTV 251
                       **********************************************************************754..467777777777****** PP

              GRAS 352 eeesgslvlgWkdrpLvsvSaWr 374
                        +e+ +lvlgWk++p++++S+W+
  LOC_Os01g67670.1 252 ADEKVCLVLGWKGKPVIAASCWK 274
                       **********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.5011255IPR005202Transcription factor GRAS
PfamPF035145.9E-6272274IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MEMDKFSSSY QPSWPPAQAT VDVVGSVETP ARRAFQRVAS FFVQELLDRR ASAGAGPCEH  60
GVLHPAVVVR EAYAEGLGMY LEFRGINRGL ESLHIDDLGV DADEAVAINS VLELHSVVKE  120
SRGALNSVLQ TIRKLSPRAF VLVEQDAGHN APFFLGRFME ALHYYAALFD ALDAALPRYD  180
ARRARVEQFH FGAEIRNVVG CEGAARVERH ERADQWRRRM SRAGFQSVPI KMAAKAREWL  240
DENAGGDGYT VADEKVCLVL GWKGKPVIAA SCWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2873274170375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g67670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g67670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0067570.0AP006757.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0551C06.
GenBankAP0037910.0AP003791.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1065G12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646199.11e-142PREDICTED: DELLA protein RGL1-like
TrEMBLA2WY200.0A2WY20_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0FX740.0A0A0E0FX74_ORYNI; Uncharacterized protein
STRINGLOC_Os01g67670.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP70521119
MonocotsOGMP56403354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.13e-33GRAS family protein