PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g67650.1
Common NameB1065G12.22, P0551C06.29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 533aa    MW: 57449.2 Da    PI: 6.5058
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g67650.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS345.77.8e-1061575311374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsely.kal..ppsetsekn..sseelaalklfsevs 88 
                       lv+lL++cAeav+ +d ++a alL +l+  a  +g+++qR+a++f+++La rl    +     a    + + s+       +  al l +e++
  LOC_Os01g67650.1 157 LVQLLVACAEAVACRDRAQAAALLRELQAGAPVHGTAFQRVASCFVQGLADRLPLAHPPALgPASmaFCIPPSSCAgrDGARGEALALAYELC 249
                       689*************************************************987444332122211222222222345667788889***** PP

              GRAS  89 PilkfshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                       P+l+f+h++aN  +lea+ege+ vH++D++++     G QW  Ll+ La+R++g+p ++R+Tgvg+    + ++++++g+ L+ +Ae lg+ +
  LOC_Os01g67650.1 250 PYLRFAHFVANACMLEAFEGESNVHVVDLGMTlgldRGHQWRGLLDGLAARASGKPaRVRVTGVGA----RMDTMRAIGRELEAYAEGLGMYL 338
                       ****************************98762222567*************77666*********....9********************** PP

              GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                       ef+  + + le+l++++L v+ +Ea+a+n+vl+lh++++es    +   +vL+++++lsP+ +v+veq+a hn++ Fl rf+eal+yy+alfd
  LOC_Os01g67650.1 339 EFRG-INRGLESLHIDDLGVDADEAVAINSVLELHSVVKESRGALN---SVLQTIRKLSPRAFVLVEQDAGHNGPFFLGRFMEALHYYAALFD 427
                       ****.799******************************88877777...8******************************************* PP

              GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                       +l+a lpr +  r+ vE++ +g ei+nvv cega+r+erhe++ +Wr+r+++aGF++vp++    ++a+  l + + + gy+v ee+g+lvlg
  LOC_Os01g67650.1 428 ALDAALPRYDARRARVEQFHFGAEIRNVVGCEGAARVERHERADQWRRRMSRAGFQSVPIKMA--AKAREWLDENAgGGGYTVAEEKGCLVLG 518
                       ************************************************************754..467777777776999************* PP

              GRAS 362 WkdrpLvsvSaWr 374
                       Wk++p++++S+W+
  LOC_Os01g67650.1 519 WKGKPVIAASCWK 531
                       ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.829131512IPR005202Transcription factor GRAS
PfamPF035142.7E-103157531IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MGMSPEPCNS ISDCSQQQSH HLTLTQQQDS TIICTNQELD YYYRFYDVDE AAFDGNEVEL  60
VSRFSKVTRM DHMISSPYQP TWSPAQAAVD VVGSSETSRV RKKRFWDVLE SCKQKVEAME  120
AMDTPATATF RVGAGDGGGG GGGGAGGGGG GADGMRLVQL LVACAEAVAC RDRAQAAALL  180
RELQAGAPVH GTAFQRVASC FVQGLADRLP LAHPPALGPA SMAFCIPPSS CAGRDGARGE  240
ALALAYELCP YLRFAHFVAN ACMLEAFEGE SNVHVVDLGM TLGLDRGHQW RGLLDGLAAR  300
ASGKPARVRV TGVGARMDTM RAIGRELEAY AEGLGMYLEF RGINRGLESL HIDDLGVDAD  360
EAVAINSVLE LHSVVKESRG ALNSVLQTIR KLSPRAFVLV EQDAGHNGPF FLGRFMEALH  420
YYAALFDALD AALPRYDARR ARVEQFHFGA EIRNVVGCEG AARVERHERA DQWRRRMSRA  480
GFQSVPIKMA AKAREWLDEN AGGGGYTVAE EKGCLVLGWK GKPVIAASCW KC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-541575314375GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8RZ73
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g67650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g67650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0067570.0AP006757.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0551C06.
GenBankAP0037910.0AP003791.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1065G12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646199.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLQ8RZ730.0Q8RZ73_ORYSJ; Gibberellin response modulator-like protein
STRINGLOC_Os01g67650.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP70521119
MonocotsOGMP56403354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-60RGA-like 1