PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g66590.2
Common NameAS2, B1099D03.43, CRLL3, LBD6, LOC4324906, Os01g0889400, OsJ_04355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 270aa    MW: 27621.9 Da    PI: 8.0637
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g66590.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.87.7e-4338136199
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+v++i+ lq++l+ql+++
  LOC_Os01g66590.2  38 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVAIISILQRNLRQLQQD 130
                       7******************************************************************************************** PP

            DUF260  94 lallke 99 
                       la++k 
  LOC_Os01g66590.2 131 LARAKF 136
                       *99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.33237138IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4238134IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MASSSASSVP APSGSVITIA SASASAAANT AACGTGSPCA ACKFLRRKCQ PDCVFAPYFP  60
PDNPQKFVHV HRVFGASNVT KLLNELHPYQ REDAVNSLAY EADMRLRDPV YGCVAIISIL  120
QRNLRQLQQD LARAKFELSK YQQAAAAAAA ASASTGTNNG PHSMAEFIGN AVPNGAQSFI  180
NVGHSAALAS VGGAAACFGQ EQQFSAVHML SRSYEGEPIA RLGGNGGYEF GYSTSMAGGG  240
HMSGLGALGG APFLKSGIAG SDERQGAGQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.184590.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379891980.0
Expression AtlasQ8LQH4-
Functional Description ? help Back to Top
Source Description
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g66590.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g66590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2002370.0AB200237.1 Oryza sativa Japonica Group CRLL3 mRNA for LOB domain protein, complete cds.
GenBankAK1195750.0AK119575.1 Oryza sativa Japonica Group cDNA clone:002-117-B04, full insert sequence.
GenBankAK0714070.0AK071407.1 Oryza sativa Japonica Group cDNA clone:J023089G14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634701.10.0PREDICTED: LOB domain-containing protein 6
SwissprotQ8LQH40.0LBD6_ORYSJ; LOB domain-containing protein 6
SwissprotA2WXT00.0LBD6_ORYSI; LOB domain-containing protein 6
TrEMBLA0A0E0N6260.0A0A0E0N626_ORYRU; Uncharacterized protein
STRINGBGIOSGA004955-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g66590.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.44e-54LBD family protein
Publications ? help Back to Top
  1. Inukai Y, et al.
    Crown rootless1, which is essential for crown root formation in rice, is a target of an AUXIN RESPONSE FACTOR in auxin signaling.
    Plant Cell, 2005. 17(5): p. 1387-96
    [PMID:15829602]