PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g66490.1
Common NameLOC4324898, Os01g0888300, OSNPB_010888300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 453aa    MW: 48535 Da    PI: 9.0804
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g66490.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.18.8e-50631882128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                       +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +
  LOC_Os01g66490.1  63 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRA 154
                       79***************************.89***************888889**************************************** PP

               NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  LOC_Os01g66490.1 155 ENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 188
                       ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.24662209IPR003441NAC domain
SuperFamilySSF1019411.96E-5562208IPR003441NAC domain
PfamPF023651.7E-2464188IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MHMRRGRAAG GEGEAAAVVV MNRYDNNGHA AAAAAAAVAG GGGGGGGNKA AGEVDGHEDD  60
LVMPGFRFHP TEEELIEFYL RRKVEGKRFN VELITFLDLY RYDPWELPAM AAIGEKEWFF  120
YVPRDRKYRN GDRPNRVTAS GYWKATGADR MIRAENNRPI GLKKTLVFYS GKAPKGVRSS  180
WIMNEYRLPP ADTDRYHKTE ISLCRVYKRT GIDDGHGQVS TARSSAHSRG GGAAPVQDNK  240
QGSSSTSTPT PPPTPSKLHL LSSECTSPPA IVTDHAAMVA HKAPSPRHHQ QQQQLHAAKP  300
CGGYLQNSSM ASAAGGDQQQ QFQQDFAAAL YQQYSKNTSG AFASTYSLLN LVNAASMGSS  360
AAAIDELSSL VGHGTPSYIN PAAGSHNYSQ FLHLPTTPSS HQPTPAPLGT TTAAAAATLP  420
MSLAAFSDRI WDWNNPIPEA GGRDYSTSTG FK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-536420919165NAC domain-containing protein 19
4dul_A1e-536420919165NAC domain-containing protein 19
1ut7_B1e-536420919165NO APICAL MERISTEM PROTEIN
1ut7_A1e-536420919165NO APICAL MERISTEM PROTEIN
1ut4_B1e-536420919165NO APICAL MERISTEM PROTEIN
1ut4_A1e-536420919165NO APICAL MERISTEM PROTEIN
3swp_D2e-536420922168NAC domain-containing protein 19
3swp_C2e-536420922168NAC domain-containing protein 19
3swp_B2e-536420922168NAC domain-containing protein 19
3swp_A2e-536420922168NAC domain-containing protein 19
3swm_D2e-536420922168NAC domain-containing protein 19
3swm_C2e-536420922168NAC domain-containing protein 19
3swm_B2e-536420922168NAC domain-containing protein 19
3swm_A2e-536420922168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.327860.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329881110.0
Expression AtlasQ0JH26-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g66490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g66490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1029020.0AK102902.1 Oryza sativa Japonica Group cDNA clone:J033113D13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631974.10.0PREDICTED: protein BEARSKIN1
TrEMBLQ0JH260.0Q0JH26_ORYSJ; Os01g0888300 protein
STRINGLOC_Os01g66490.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-101NAC domain containing protein 35