PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g66290.1
Common NameLOC4324888, MADS21, Os01g0886200, OsJ_04337, P0408G07.26, P0434C04.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 266aa    MW: 29393.1 Da    PI: 8.6212
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g66290.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.3e-29959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+ rqvtf+kRrng+lKKA+EL +LCdae+a+i+fss+g+lye+s+
  LOC_Os01g66290.1  9 KRIENKTSRQVTFCKRRNGLLKKAYELAILCDAEIALIVFSSRGRLYEFSN 59
                      79***********************************************95 PP

2K-box108.57.6e-36841759100
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                        + + +++ qqe+ak++ +i++Lq+ +Rhl+Ge++++++ keL++Le++Lek++++iRskK+ell+++ie++qk+e +lq+en+ Lr+k++e
  LOC_Os01g66290.1  84 IDVNSHQYFQQEAAKMRHQIQTLQNANRHLIGESIGNMTAKELKSLENRLEKGISRIRSKKHELLFSEIEYMQKREADLQNENMFLRAKVAE 175
                       566889***********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.4E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.305161IPR002100Transcription factor, MADS-box
CDDcd002655.23E-44276No hitNo description
SuperFamilySSF554559.29E-31275IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2886173IPR002487Transcription factor, K-box
PROSITE profilePS5129714.81489179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRGKIEIKR IENKTSRQVT FCKRRNGLLK KAYELAILCD AEIALIVFSS RGRLYEFSNV  60
NSTRSTIERY KKASASTSGS APVIDVNSHQ YFQQEAAKMR HQIQTLQNAN RHLIGESIGN  120
MTAKELKSLE NRLEKGISRI RSKKHELLFS EIEYMQKREA DLQNENMFLR AKVAEAERAE  180
HDDQQAAEDD EMAPAPAVGG GSSSGTELEA LPATFDTREY YQPAPPVSML AAAAAAAAAQ  240
YSSDHHQTAL HLGYFKVDSG KGGLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-19168168Myocyte-specific enhancer factor 2B
1tqe_R4e-19168168Myocyte-specific enhancer factor 2B
1tqe_Q4e-19168168Myocyte-specific enhancer factor 2B
1tqe_P4e-19168168Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.280210.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329809810.0
Expression AtlasQ8RU31-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing seeds. {ECO:0000269|PubMed:14701936}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g66290.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g66290
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7509440.0FJ750944.1 Oryza sativa clone KCS020C02 MADS-box transcription factor 21 mRNA, complete cds.
GenBankAY5519130.0AY551913.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS207 mRNA, complete cds.
GenBankAK0709580.0AK070958.1 Oryza sativa Japonica Group cDNA clone:J023065L09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621182.10.0PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU310.0MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLA2WXQ40.0A2WXQ4_ORYSI; Putative uncharacterized protein
TrEMBLD3U2H60.0D3U2H6_ORYSA; MADS-box transcription factor 21
STRINGLOC_Os01g66290.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA004940-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.19e-86MIKC_MADS family protein
Publications ? help Back to Top
  1. Lee S, et al.
    Systematic reverse genetic screening of T-DNA tagged genes in rice for functional genomic analyses: MADS-box genes as a test case.
    Plant Cell Physiol., 2003. 44(12): p. 1403-11
    [PMID:14701936]