PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g66120.3
Common NameB1065E10.51, LOC4325006, NAC48, NAC6, Os01g0884300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 248aa    MW: 26472.2 Da    PI: 9.6984
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g66120.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM96.93.1e-3057754128
               NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v s   + v +kk Lvfy g+apkgekt+W+mheyrl
  LOC_Os01g66120.3   5 GEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGS--PKPVAIKKALVFYAGKAPKGEKTNWIMHEYRL 77 
                       579************************************99..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.6081103IPR003441NAC domain
SuperFamilySSF1019412.62E-363103IPR003441NAC domain
PfamPF023652.1E-14977IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MALYGEKEWY FFSPRDRKYP NGSRPNRAAG SGYWKATGAD KPVGSPKPVA IKKALVFYAG  60
KAPKGEKTNW IMHEYRLADV DRSARKKNSL RLDDWVLCRI YNKKGGLEKP PAAAVAAAGM  120
VSSGGGVQRK PMVGVNAAVS SPPEQKPVVA GPAFPDLAAY YDRPSDSMPR LHADSSCSEQ  180
VLSPEFACEV QSQPKISEWE RTFATVGPIN PAASILDPAG SGGLGGLGGG GSDPLLQDIL  240
MYWGKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-49210966171NO APICAL MERISTEM PROTEIN
1ut4_B9e-49210966171NO APICAL MERISTEM PROTEIN
1ut7_A9e-49210966171NO APICAL MERISTEM PROTEIN
1ut7_B9e-49210966171NO APICAL MERISTEM PROTEIN
3swm_A1e-48210969174NAC domain-containing protein 19
3swm_B1e-48210969174NAC domain-containing protein 19
3swm_C1e-48210969174NAC domain-containing protein 19
3swm_D1e-48210969174NAC domain-containing protein 19
3swp_A1e-48210969174NAC domain-containing protein 19
3swp_B1e-48210969174NAC domain-containing protein 19
3swp_C1e-48210969174NAC domain-containing protein 19
3swp_D1e-48210969174NAC domain-containing protein 19
4dul_A9e-49210966171NAC domain-containing protein 19
4dul_B9e-49210966171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.519264e-79callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154845144e-79
Expression AtlasQ7F2L3-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10660065}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g66120.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g66120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8469930.0EU846993.1 Oryza sativa Japonica Group clone KCS089G05 NAC6 protein mRNA, complete cds.
GenBankAB0281850.0AB028185.1 Oryza sativa mRNA for OsNAC6 protein, complete cds.
GenBankAK0683920.0AK068392.1 Oryza sativa Japonica Group cDNA clone:J013149P14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620920.11e-179PREDICTED: NAC domain-containing protein 48
SwissprotQ7F2L30.0NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLA0A0E0N5X51e-179A0A0E0N5X5_ORYRU; Uncharacterized protein
TrEMBLQ0JH481e-179Q0JH48_ORYSJ; NAC6 protein
STRINGLOC_Os01g66120.11e-179(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-84NAC family protein
Publications ? help Back to Top
  1. Kikuchi K, et al.
    Molecular analysis of the NAC gene family in rice.
    Mol. Gen. Genet., 2000. 262(6): p. 1047-51
    [PMID:10660065]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]