PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g66120.1
Common NameB1065E10.51, LOC4325006, NAC48, NAC6, Os01g0884300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 304aa    MW: 32906.7 Da    PI: 9.0566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g66120.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.51.9e-5191331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelv++yL+++++g ++ +  +i+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v 
  LOC_Os01g66120.1   9 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVG 100
                       79**************************99.88***************7666789*************************************9 PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s   + v +kk Lvfy g+apkgekt+W+mheyrl
  LOC_Os01g66120.1 101 S--PKPVAIKKALVFYAGKAPKGEKTNWIMHEYRL 133
                       9..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-626159IPR003441NAC domain
PROSITE profilePS5100559.7479159IPR003441NAC domain
PfamPF023652.2E-2610133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSGGQDLQLP PGFRFHPTDE ELVMHYLCRR CAGLPIAVPI IAEIDLYKFD PWQLPRMALY  60
GEKEWYFFSP RDRKYPNGSR PNRAAGSGYW KATGADKPVG SPKPVAIKKA LVFYAGKAPK  120
GEKTNWIMHE YRLADVDRSA RKKNSLRLDD WVLCRIYNKK GGLEKPPAAA VAAAGMVSSG  180
GGVQRKPMVG VNAAVSSPPE QKPVVAGPAF PDLAAYYDRP SDSMPRLHAD SSCSEQVLSP  240
EFACEVQSQP KISEWERTFA TVGPINPAAS ILDPAGSGGL GGLGGGGSDP LLQDILMYWG  300
KPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-79616512174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7F2L3
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10660065}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g66120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g66120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8469930.0EU846993.1 Oryza sativa Japonica Group clone KCS089G05 NAC6 protein mRNA, complete cds.
GenBankAB0281850.0AB028185.1 Oryza sativa mRNA for OsNAC6 protein, complete cds.
GenBankAK0683920.0AK068392.1 Oryza sativa Japonica Group cDNA clone:J013149P14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620920.10.0PREDICTED: NAC domain-containing protein 48
SwissprotQ7F2L30.0NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLA0A0E0N5X50.0A0A0E0N5X5_ORYRU; Uncharacterized protein
TrEMBLQ0JH480.0Q0JH48_ORYSJ; NAC6 protein
STRINGLOC_Os01g66120.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-120NAC family protein
Publications ? help Back to Top
  1. Kikuchi K, et al.
    Molecular analysis of the NAC gene family in rice.
    Mol. Gen. Genet., 2000. 262(6): p. 1047-51
    [PMID:10660065]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]