PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g66030.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 165aa    MW: 19012 Da    PI: 9.5226
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g66030.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.81.6e-29959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien++nrqvtfskRr gilKKA E+SvLCdaev v+ifss gkly+y+s
  LOC_Os01g66030.2  9 KRIENSTNRQVTFSKRRSGILKKAREISVLCDAEVGVVIFSSAGKLYDYCS 59
                      79***********************************************96 PP

2K-box70.55e-2471142172
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnel 72 
                       yq++sgk l+++k++sl+ e++++kke++n+q e+Rhl+GedL+sL+ keL  +e++L++++ ++ +k +++
  LOC_Os01g66030.2  71 YQTNSGKILWDEKHKSLSAEIDRIKKENDNMQIELRHLKGEDLNSLQPKELIMIEEALDNGIVNVNDKLMDH 142
                       89999999*********************************************************9997766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.039161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-34296IPR002100Transcription factor, MADS-box
CDDcd002652.31E-42280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-30323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-1382143IPR002487Transcription factor, K-box
PROSITE profilePS512979.7984164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010097Biological Processspecification of stamen identity
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRSGILK KAREISVLCD AEVGVVIFSS AGKLYDYCSP  60
KTSLSRILEK YQTNSGKILW DEKHKSLSAE IDRIKKENDN MQIELRHLKG EDLNSLQPKE  120
LIMIEEALDN GIVNVNDKLM DHWERIRCWK TRTSCWLLNC TSKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-21186178Myocyte-specific enhancer factor 2B
1tqe_Q5e-21186178Myocyte-specific enhancer factor 2B
1tqe_R5e-21186178Myocyte-specific enhancer factor 2B
1tqe_S5e-21186178Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.4290.0callus| flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO453859690.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g66030.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g66030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0956450.0AF095645.1 Oryza sativa MADS box protein nmads1 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623988.11e-102PREDICTED: MADS-box transcription factor 2 isoform X1
SwissprotQ407021e-104MADS2_ORYSJ; MADS-box transcription factor 2
TrEMBLA0A0E0CB621e-102A0A0E0CB62_9ORYZ; Uncharacterized protein
TrEMBLA0A0D3EX301e-102A0A0D3EX30_9ORYZ; Uncharacterized protein
TrEMBLA2WXN31e-102A2WXN3_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0FWN01e-102A0A0E0FWN0_ORYNI; Uncharacterized protein
TrEMBLA0A0E0JRV41e-102A0A0E0JRV4_ORYPU; Uncharacterized protein
TrEMBLI1NU031e-102I1NU03_ORYGL; Uncharacterized protein
TrEMBLA0A0D9YIA51e-102A0A0D9YIA5_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g66030.11e-101(Oryza sativa Japonica Group)
STRINGBGIOSGA000377-PA1e-101(Oryza sativa Indica Group)
STRINGORGLA01G0334300.11e-101(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.19e-62MIKC_MADS family protein