PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g66030.1
Common NameB1065E10.30, LOC4325001, MADS, MADS2, Os01g0883100, OsJ_04312
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 24157.6 Da    PI: 7.7032
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g66030.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.5e-29959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien++nrqvtfskRr gilKKA E+SvLCdaev v+ifss gkly+y+s
  LOC_Os01g66030.1  9 KRIENSTNRQVTFSKRRSGILKKAREISVLCDAEVGVVIFSSAGKLYDYCS 59
                      79***********************************************96 PP

2K-box78.12.2e-2671167197
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       yq++sgk l+++k++sl+ e++++kke++n+q e+Rhl+GedL+sL+ keL  +e++L++++ ++ +k ++++ +++++ ++ e+e++    +
  LOC_Os01g66030.1  71 YQTNSGKILWDEKHKSLSAEIDRIKKENDNMQIELRHLKGEDLNSLQPKELIMIEEALDNGIVNVNDKLMDHWERHVRTDKMLEDENKLLAFK 163
                       89999999************************************************************************************* PP

             K-box  94 Lrkk 97 
                       L+++
  LOC_Os01g66030.1 164 LHQQ 167
                       9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.039161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-34296IPR002100Transcription factor, MADS-box
CDDcd002651.19E-43280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-30323IPR002100Transcription factor, MADS-box
PfamPF003195.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-1582164IPR002487Transcription factor, K-box
PROSITE profilePS5129712.22284170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010097Biological Processspecification of stamen identity
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRSGILK KAREISVLCD AEVGVVIFSS AGKLYDYCSP  60
KTSLSRILEK YQTNSGKILW DEKHKSLSAE IDRIKKENDN MQIELRHLKG EDLNSLQPKE  120
LIMIEEALDN GIVNVNDKLM DHWERHVRTD KMLEDENKLL AFKLHQQDIA LSGSMRDLEL  180
GYHPDRDFAA QMPITFRVQP SHPNLQENN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-20186178Myocyte-specific enhancer factor 2B
1tqe_R3e-20186178Myocyte-specific enhancer factor 2B
1tqe_Q3e-20186178Myocyte-specific enhancer factor 2B
1tqe_P3e-20186178Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.4290.0callus| flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO453859690.0
Expression AtlasQ40702-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in lodicules and stamens from early to late stage of flower development. {ECO:0000269|PubMed:10945340, ECO:0000269|Ref.1}.
UniprotTISSUE SPECIFICITY: Highly expressed in anthers and carpels. Expressed in pollen, tapetum and stigma. {ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules (whorl 2). {ECO:0000269|PubMed:14704206}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g66030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q40702
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g66030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519240.0AY551924.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS219 mRNA, complete cds.
GenBankAK0708940.0AK070894.1 Oryza sativa Japonica Group cDNA clone:J023072H23, full insert sequence.
GenBankRICOSMA0.0L37526.1 Oryza sativa MADS-box protein (MADS2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623988.11e-155PREDICTED: MADS-box transcription factor 2 isoform X1
SwissprotQ407021e-157MADS2_ORYSJ; MADS-box transcription factor 2
TrEMBLA0A0D3EX301e-155A0A0D3EX30_9ORYZ; Uncharacterized protein
TrEMBLA2WXN31e-155A2WXN3_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0FWN01e-155A0A0E0FWN0_ORYNI; Uncharacterized protein
TrEMBLA0A0E0JRV41e-155A0A0E0JRV4_ORYPU; Uncharacterized protein
TrEMBLI1NU031e-155I1NU03_ORYGL; Uncharacterized protein
TrEMBLA0A0D9YIA51e-155A0A0D9YIA5_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g66030.11e-154(Oryza sativa Japonica Group)
STRINGBGIOSGA000377-PA1e-154(Oryza sativa Indica Group)
STRINGORGLA01G0334300.11e-154(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP53021222
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.13e-74MIKC_MADS family protein
Publications ? help Back to Top
  1. Kyozuka J,Kobayashi T,Morita M,Shimamoto K
    Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes.
    Plant Cell Physiol., 2000. 41(6): p. 710-8
    [PMID:10945340]
  2. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  3. Prasad K,Vijayraghavan U
    Double-stranded RNA interference of a rice PI/GLO paralog, OsMADS2, uncovers its second-whorl-specific function in floral organ patterning.
    Genetics, 2003. 165(4): p. 2301-5
    [PMID:14704206]