PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g65900.1
Common NameB1065E10.4, LOC4324850, Os01g0881500, OsJ_04302, OSNPB_010881500, P0018C10.63
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 554aa    MW: 61798.5 Da    PI: 4.5501
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g65900.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.36.1e-1311845532374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cA a+s+ +  +aqa+++ l++++s +gdp qR+aay++e+Laar++ s++++ykal+++e +   +  +l+a+++++e++P+++f+
  LOC_Os01g65900.1 184 KQLLFDCAMALSDYNVDEAQAIITDLRQMVSIQGDPSQRIAAYLVEGLAARIVASGKGIYKALSCKEPP---TLYQLSAMQILFEICPCFRFG 273
                       589*****************************************************************9...89999**************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +++aN aIlea +ge+rvHiiDfdi+qG Q+++L+q L + +++p +lRiTgv++pe++      l+ +g+rL+k+Ae +g++fef++ v  +
  LOC_Os01g65900.1 274 FMAANYAILEACKGEDRVHIIDFDINQGSQYITLIQFLKNNANKPRHLRITGVDDPETVqrTVGGLKVIGQRLEKLAEDCGISFEFRA-VGAN 365
                       *********************************************************99778889***********************.799* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       + d+++ +L++ pgEal+Vn+++qlh+l+desvs+ +erd++L++vk+l+Pk+v++veq+a++n+++F +rf e  +yy+alfdsl+a+lpre
  LOC_Os01g65900.1 366 IGDVTPAMLDCCPGEALVVNFAFQLHHLPDESVSIMNERDQLLRMVKGLQPKLVTLVEQDANTNTAPFQTRFREVYDYYAALFDSLDATLPRE 458
                       ********************************************************************************************* PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       s +r++vEr++l+reivn++aceg +r+er e ++kWr+r+++aGF+p p+s+++ + +++ll+ + ++ y+ ee++g l +gW +++L++ S
  LOC_Os01g65900.1 459 SPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARMTMAGFTPCPFSSNVISGIRSLLKSYCDR-YKFEEDHGGLHFGWGEKTLIVSS 550
                       *******************************************************************66.*********************** PP

              GRAS 372 aWr 374
                       aW+
  LOC_Os01g65900.1 551 AWQ 553
                       **6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.078157534IPR005202Transcription factor GRAS
PfamPF035142.1E-128184553IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MSFIRRADPS TTYADNLYIH KFGTPNSNFA ARRYASDTQL FRYGPEPYNP ENSFYNQQAS  60
PMPYMVTADG HSPSSADNSC SDVAKDSPLV SNVSQQNSQS ISDNQSSELE VEFDEDDIRM  120
KLQELEHALL DDSDDILYEI SQAGSINDEW ADPMKNVILP NSPKESESSI SCAGSNNGEP  180
RTPKQLLFDC AMALSDYNVD EAQAIITDLR QMVSIQGDPS QRIAAYLVEG LAARIVASGK  240
GIYKALSCKE PPTLYQLSAM QILFEICPCF RFGFMAANYA ILEACKGEDR VHIIDFDINQ  300
GSQYITLIQF LKNNANKPRH LRITGVDDPE TVQRTVGGLK VIGQRLEKLA EDCGISFEFR  360
AVGANIGDVT PAMLDCCPGE ALVVNFAFQL HHLPDESVSI MNERDQLLRM VKGLQPKLVT  420
LVEQDANTNT APFQTRFREV YDYYAALFDS LDATLPRESP DRMNVERQCL AREIVNILAC  480
EGPDRVERYE VAGKWRARMT MAGFTPCPFS SNVISGIRSL LKSYCDRYKF EEDHGGLHFG  540
WGEKTLIVSS AWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-551855536375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.99020.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329774750.0
Expression AtlasQ8RZQ6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g65900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g65900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0674570.0AK067457.1 Oryza sativa Japonica Group cDNA clone:J013106L10, full insert sequence.
GenBankAK0608330.0AK060833.1 Oryza sativa Japonica Group cDNA clone:001-034-C07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610828.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLQ8RZQ60.0Q8RZQ6_ORYSJ; Os01g0881500 protein
STRINGLOC_Os01g65900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP82621116
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1