PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g65370.1
Common NameLOC4324770, Os01g0874300, OsJ_04260, OSNPB_010874300, P0491F11.40, P0648C09.6, P0698A10.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 288aa    MW: 30969.9 Da    PI: 9.3729
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g65370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  LOC_Os01g65370.1 14 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding54.23.3e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T ++del+++++++lG++ W++Ia  ++ gRt++++k++w+++
  LOC_Os01g65370.1  67 RGNFTDDDDELIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.243961IPR017930Myb domain
SMARTSM007174.1E-141363IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-2913108IPR009057Homeodomain-like
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001676.04E-121661No hitNo description
PROSITE profilePS5129427.64762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-2765116IPR009057Homeodomain-like
SMARTSM007174.0E-1666114IPR001005SANT/Myb domain
PfamPF002493.6E-1567111IPR001005SANT/Myb domain
CDDcd001672.67E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDDDDELIIK LHALLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLSRG  120
IDPQTHRPVS AGSSAAAASG LTTTASTAAF PSLAPAPPPQ QHRLHNPVHA AAPSNASFAR  180
SAASPPSEDG HSSSGGSSDA PRCPDLNLDL DLDLSMSLPS SPPKTPAAAS STTASRHHHH  240
QQQKTICLCY HLGVRNGDVC SCKAAAPSPA GPRAFRFLRP LEEGQYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.101751e-155flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977241501e-155
Expression AtlasQ8RUI9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g65370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g65370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0606840.0AK060684.1 Oryza sativa Japonica Group cDNA clone:001-029-F12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627699.10.0PREDICTED: myb-related protein 308
SwissprotP813933e-96MYB08_ANTMA; Myb-related protein 308
TrEMBLA2WXH60.0A2WXH6_ORYSI; Putative uncharacterized protein
TrEMBLI1NTU80.0I1NTU8_ORYGL; Uncharacterized protein
TrEMBLQ8RUI90.0Q8RUI9_ORYSJ; Os01g0874300 protein
STRINGLOC_Os01g65370.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA004902-PA0.0(Oryza sativa Indica Group)
STRINGORGLA01G0328800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-86myb domain protein 4