PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g64730.1
Common NameLOC4325078, Os01g0867300, OSNPB_010867300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 267aa    MW: 28062 Da    PI: 8.9502
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g64730.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42.1e-15184236355
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                       + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN ++ ke ee  ++
  LOC_Os01g64730.1 184 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAKMFKEQEEQHQK 236
                       689*************************************9998877655444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-8182246IPR004827Basic-leucine zipper domain
PfamPF001703.4E-14184242IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657184248IPR004827Basic-leucine zipper domain
CDDcd147072.00E-20186236No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-13187245No hitNo description
SuperFamilySSF579591.06E-10187234No hitNo description
PROSITE patternPS000360189204IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MMASRVMASS SPSHTASDLA RFAAGRGGGG SAGLGSMNVE EILRGIYADM PTPALPLVGG  60
DRPMSPLPAP DVAAAPRTAE EVWKEITGAG VAAAAGGVVP PAAAAAAAPA VVAGAGAGTG  120
AEMTLEDFLA REGAVKEDEA VVTDPSAAKG QVVMGFLNGA EVTGGVTGGR SRKRHLMDPM  180
DRAAMQRQKR MIKNRESAAR SRERKQAYIA ELESLVTQLE EENAKMFKEQ EEQHQKRLKE  240
LKEMVVPVII RKTSARDLRR TNSMEW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.882350.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329779370.0
Expression AtlasQ0JHF1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g64730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g64730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ9042380.0GQ904238.1 Oryza sativa Japonica Group ABA responsive element binding factor 1 mRNA, complete cds.
GenBankAK0679190.0AK067919.1 Oryza sativa Japonica Group cDNA clone:J013123H12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612904.10.0PREDICTED: G-box-binding factor 4
SwissprotP427771e-31GBF4_ARATH; G-box-binding factor 4
TrEMBLQ0JHF10.0Q0JHF1_ORYSJ; ABA responsive element binding factor 1
STRINGLOC_Os01g64730.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9845410
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.16e-33bZIP family protein
Publications ? help Back to Top
  1. Amir Hossain M, et al.
    The bZIP transcription factor OsABF1 is an ABA responsive element binding factor that enhances abiotic stress signaling in rice.
    Plant Mol. Biol., 2010. 72(4-5): p. 557-66
    [PMID:20039193]