PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g64590.1
Common NameLOC4324797, Os01g0865800, OSNPB_010865800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 321aa    MW: 33781.5 Da    PI: 4.5088
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g64590.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.5e-382380461
            zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                      +a +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  LOC_Os01g64590.1 23 AAPNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 80
                      5679***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31769IPR003851Zinc finger, Dof-type
PfamPF027016.8E-322479IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8542579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MLPYAPRPPS LLVDRRYKQG AEAAPNCPRC DSPNTKFCYY NNYSLSQPRY FCKGCRRYWT  60
KGGSLRNVPV GGGCRKNRRG KSSSSARSAA DAVSSGRDAA FGHRFPGPVR PDMVLEGMVG  120
NPANPGQAMP DVAAAADGST IDLAMLYAKF LNHPPTDAGL GAVTPESGGH VDEAFDTFSA  180
SSDLSPGILA AASAQFDPNQ DGFGEWSSPA SGNDPTSTAT TATTSMLCTD ASVQAALGEL  240
NFAMDQSCFD SLGLPTDVAG AGSLSSWCSI VPSLSTWEEP KYDSLDSFPD DAMSLHECMI  300
GAPDHDWSVD CQGLEALYMP *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.123980.0stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0VAX4
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g64590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g64590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032700.0AP003270.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0505D12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646108.10.0PREDICTED: uncharacterized protein LOC4324797
TrEMBLA0A0P0VAX40.0A0A0P0VAX4_ORYSJ; Os01g0865800 protein
TrEMBLA0A0E0FW460.0A0A0E0FW46_ORYNI; Uncharacterized protein
TrEMBLA0A0E0N5H10.0A0A0E0N5H1_ORYRU; Uncharacterized protein
STRINGLOC_Os01g64590.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA000434-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.13e-29Dof family protein