PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g64360.1
Common NameLOC4324783, OsJ_04166
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 174aa    MW: 19318.5 Da    PI: 8.4787
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g64360.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.8e-081563147
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      r +W++ Ed+ +  a  + + +   +W+++a+ ++ gRt+ +  +++q +
  LOC_Os01g64360.1 15 RRPWSKVEDKVFESALVLCPEDvpdRWALVAAQLP-GRTPQEALEHYQVL 63
                      679********************************.******99999976 PP

2Myb_DNA-binding41.33.6e-13106150347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W+++E+ l++++  ++G g+W+ I+r    +Rt+ q+ s+ qky
  LOC_Os01g64360.1 106 PWSEDEHRLFLEGLDRYGRGDWRNISRFSVRTRTPTQVASHAQKY 150
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.4671068IPR017930Myb domain
SuperFamilySSF466891.29E-101263IPR009057Homeodomain-like
SMARTSM007175.0E-61466IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-61562IPR009057Homeodomain-like
PfamPF002492.3E-61562IPR001005SANT/Myb domain
CDDcd001671.82E-51764No hitNo description
PROSITE profilePS5129418.86699155IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-10100156IPR009057Homeodomain-like
SuperFamilySSF466895.02E-17101155IPR009057Homeodomain-like
SMARTSM007173.3E-10103153IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.4E-16103154IPR006447Myb domain, plants
PfamPF002498.9E-11106150IPR001005SANT/Myb domain
CDDcd001675.85E-10106151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MDLYGAAAGG GPVARRPWSK VEDKVFESAL VLCPEDVPDR WALVAAQLPG RTPQEALEHY  60
QVLVADIDLI MRGAVDAPGS WDDNDGNDRR GGGGKPRGEE RRRGVPWSED EHRLFLEGLD  120
RYGRGDWRNI SRFSVRTRTP TQVASHAQKY FIRQANAGAR DSKRKSIHDI TTP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1716105990RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497871e-130flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379882341e-130
Expression AtlasA2ZZU5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g64360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g64360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2628330.0KM262833.1 Oryza sativa Indica Group cultivar Nagina 22 MYB transcription factor (MYB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622460.11e-124PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-49DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA2ZZU51e-124A2ZZU5_ORYSJ; Uncharacterized protein
TrEMBLA0A0E0N5F11e-124A0A0E0N5F1_ORYRU; Uncharacterized protein
STRINGLOC_Os01g64360.11e-124(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-44MYB family protein