PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g64310.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 185aa    MW: 20727.4 Da    PI: 9.0509
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g64310.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.11.1e-4291422128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk......kvka...eekewyfFskrdkkyatgkrknratksgyWka 85 
                       +pGfrF Pt+eel+++yL++k++g + ++e+vi+ +d+y+v+P +L +         +   e + w++F++r++++a+g r++r+t sgyWka
  LOC_Os01g64310.2   9 APGFRFYPTEEELICFYLRNKLDGLRDDIERVIPVFDVYSVDPLQLSEihhemlG--GggeEGEPWFYFCPRQEREARGGRPSRTTPSGYWKA 99 
                       59***************************99***************854555431..14335669**************************** PP

               NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        g+   v+s++++ +g+kkt+vfy+grap+g+kt W m+eyr+
  LOC_Os01g64310.2 100 AGTPGVVYSADRRPIGMKKTMVFYRGRAPSGTKTAWKMNEYRA 142
                       *****************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.6628176IPR003441NAC domain
SuperFamilySSF1019411.11E-459147IPR003441NAC domain
PfamPF023653.5E-2410141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MADGGGRRAP GFRFYPTEEE LICFYLRNKL DGLRDDIERV IPVFDVYSVD PLQLSEIHHE  60
MLGGGGEEGE PWFYFCPRQE REARGGRPSR TTPSGYWKAA GTPGVVYSAD RRPIGMKKTM  120
VFYRGRAPSG TKTAWKMNEY RAFHYPDASS ASASSAGAAA PPNHLPPQVV PFYWRRVNIQ  180
TCIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-281014419144NO APICAL MERISTEM PROTEIN
1ut4_B2e-281014419144NO APICAL MERISTEM PROTEIN
1ut7_A2e-281014419144NO APICAL MERISTEM PROTEIN
1ut7_B2e-281014419144NO APICAL MERISTEM PROTEIN
3swm_A2e-281014422147NAC domain-containing protein 19
3swm_B2e-281014422147NAC domain-containing protein 19
3swm_C2e-281014422147NAC domain-containing protein 19
3swm_D2e-281014422147NAC domain-containing protein 19
3swp_A2e-281014422147NAC domain-containing protein 19
3swp_B2e-281014422147NAC domain-containing protein 19
3swp_C2e-281014422147NAC domain-containing protein 19
3swp_D2e-281014422147NAC domain-containing protein 19
4dul_A2e-281014419144NAC domain-containing protein 19
4dul_B2e-281014419144NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g64310.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g64310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0712740.0AK071274.1 Oryza sativa Japonica Group cDNA clone:J023087C18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632691.11e-121PREDICTED: NAC domain-containing protein 90 isoform X2
SwissprotQ9FMR32e-54NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0D3EWL81e-121A0A0D3EWL8_9ORYZ; Uncharacterized protein
TrEMBLA2WX861e-121A2WX86_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0N5E41e-121A0A0E0N5E4_ORYRU; Uncharacterized protein
TrEMBLI1NTL21e-121I1NTL2_ORYGL; Uncharacterized protein
TrEMBLQ94CW01e-121Q94CW0_ORYSJ; NAC transcription factor-like protein
TrEMBLA0A0E0FW201e-121A0A0E0FW20_ORYNI; Uncharacterized protein
STRINGLOC_Os01g64310.11e-121(Oryza sativa Japonica Group)
STRINGBGIOSGA004848-PA1e-121(Oryza sativa Indica Group)
STRINGORGLA01G0320200.11e-121(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-53NAC domain containing protein 90