PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g64000.3
Common NameABI5, LOC4325061, OREB1, P0489B03.11, P0679C12.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 377aa    MW: 40092.5 Da    PI: 5.1424
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g64000.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.28.7e-14304347548
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +   L++eN +Lk+ 
  LOC_Os01g64000.3 304 RRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQENARLKEA 347
                       79************************************999843 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-11300360IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657302346IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.25E-10304347No hitNo description
PfamPF001702.4E-11304347IPR004827Basic-leucine zipper domain
CDDcd147071.16E-24304345No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-13304347No hitNo description
PROSITE patternPS000360307322IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MASEMSKNVK VTDDQEVTSQ ERDQSGGTKV GGEEEIAPLA RQSSILSLTL EELQNSLCEP  60
GRNFGSMNMD EFVANIWNAE EFQATTGGCK GAMEEAKVVD SGSGSGDAGG SGLCRQGSFS  120
LPLPLCQKTV EEVWTEINQA PAHTSAPASA LQPHAGSGGV AANDRQVTLG EMTLEDFLVK  180
AGVVRGSFTG QAAMGSGMVN GPVNPMQQGQ GGPMMFPVGP VNAMYPVMGD GMGYPGGYNG  240
MAIVPPPPPA QGAMVVVSPG SSDGMSAMTH ADMMNCIGNG MMIENGTRKR PHREDGCAEK  300
TVERRQRRMI KNRESAARSR ARKQAYTVEL EAELNYLKQE NARLKEAEKT VLLTKKQMVL  360
SSPMWQSPFR IVLIVL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.105410.0callus| flower| panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8RZ35
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g64000.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g64000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ0018180.0JQ001818.1 Oryza sativa Japonica Group ABRE-binding bZIP transcription factor (OREB1) mRNA, complete cds.
GenBankEF1996310.0EF199631.1 Oryza sativa (japonica cultivar-group) bZIP-type transcription factor ABI5 isoform 2 (ABI5) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628684.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_015628691.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLQ8RZ350.0Q8RZ35_ORYSJ; ABRE-binding bZIP transcription factor
STRINGLOC_Os01g64000.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.14e-43bZIP family protein
Publications ? help Back to Top
  1. Zou M,Guan Y,Ren H,Zhang F,Chen F
    Characterization of alternative splicing products of bZIP transcription factors OsABI5.
    Biochem. Biophys. Res. Commun., 2007. 360(2): p. 307-13
    [PMID:17604002]
  2. Hong JY, et al.
    Phosphorylation-mediated regulation of a rice ABA responsive element binding factor.
    Phytochemistry, 2011. 72(1): p. 27-36
    [PMID:21055780]