PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g63680.1
Common NameLOC4324828, Os01g0855400, OSNPB_010855400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 449aa    MW: 48075.2 Da    PI: 8.0392
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g63680.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.2e-17116162148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT +Ede l++ v ++G + W+tIa+ ++ gR +kqc++rw ++l
  LOC_Os01g63680.1 116 KGAWTRQEDEVLKQMVILHGDRKWATIAKSLP-GRIGKQCRERWTNHL 162
                       79******************************.************996 PP

2Myb_DNA-binding55.11.8e-17168210145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       ++ WT+e+d  l++a+k +G++ W+ Iar+++ gR+++ +k++w+
  LOC_Os01g63680.1 168 KDVWTEEDDRMLIEAHKTYGNR-WSVIARCLP-GRSENAVKNHWN 210
                       578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.482111166IPR017930Myb domain
SuperFamilySSF466891.09E-29113209IPR009057Homeodomain-like
SMARTSM007177.8E-16115164IPR001005SANT/Myb domain
PfamPF002492.4E-15116162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-25117169IPR009057Homeodomain-like
CDDcd001671.52E-14118162No hitNo description
SMARTSM007174.8E-18167215IPR001005SANT/Myb domain
PROSITE profilePS5129418.376167217IPR017930Myb domain
PfamPF002494.0E-15168210IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-21170214IPR009057Homeodomain-like
CDDcd001678.85E-15171213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MLPTSKNKLM AAAGNSFLNQ DPTMMGSGMP HMYFASSSHG TGAHYQSPGG APITMAVPDM  60
GFLVAGIGIA PSSFVMPEGA LAASYSAMAT VPVGVVVPQQ QSSRFGGNNG NPGSFKGAWT  120
RQEDEVLKQM VILHGDRKWA TIAKSLPGRI GKQCRERWTN HLRPDIKKDV WTEEDDRMLI  180
EAHKTYGNRW SVIARCLPGR SENAVKNHWN ATKRSLKSKR RMKKKSVQVV NSPPGQLSPL  240
EEYIRSQYPS AVETTPPPPA VPAPPSDVIV HGAGSVSAGP TVATQEPTGT NPSEMGIYLG  300
LGNPAGPTTQ QLAAMNLNMS LAPDLNAYND QREGYYLPFV PQGNLHYGMH VPAPPVQQQQ  360
QQGISVDQGL HSSCLSLYHP FPGTHPVSLD FGCQSSNHAN AGGYYSEAGP SSGSGSGDPD  420
DVDVIQMASR QFLMPSEAEV TLDLTRFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-431102181110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.57150.0panicle
Os.91440.0callus| flower| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567646100.0
GEO2844317910.0
Expression AtlasA0A0P0VAQ0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g63680.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g63680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402150.0FJ940215.1 Oryza sativa Japonica Group clone KCS005D12 Myb protein mRNA, complete cds.
GenBankAK2879950.0AK287995.1 Oryza sativa Japonica Group cDNA, clone: J075101C16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645142.10.0PREDICTED: uncharacterized protein LOC4324828
TrEMBLA0A0P0VAQ00.0A0A0P0VAQ0_ORYSJ; Os01g0855400 protein
STRINGLOC_Os01g63680.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.14e-44myb domain protein 118