PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g63510.1
Common NameB1096A10.8, LOC4324824, Os01g0854500, OsJ_004011, P0529E05.42, QHB, WOX5, WOX9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 201aa    MW: 22820.6 Da    PI: 8.3453
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g63510.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.2e-201172157
                      TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      ++ R+++t+eq+++L elF+   r+ps+e++++++++l    +++ ++V++WFqN++a+e++
  LOC_Os01g63510.1 11 KCGRWNPTAEQVKVLTELFRAgLRTPSTEQIQRISTHLsafgKVESKNVFYWFQNHKARERH 72
                      568*****************99**************************************95 PP

2Wus_type_Homeobox110.96.9e-361273364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       + RW+Pt+eQ+k+L+el+++GlrtP++e+iqri+++L+++Gk+e+kNVfyWFQN+kaRer++
   LOC_Os01g63510.1 12 CGRWNPTAEQVKVLTELFRAGLRTPSTEQIQRISTHLSAFGKVESKNVFYWFQNHKARERHH 73
                       78**********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.6E-41077IPR001356Homeobox domain
PfamPF000461.0E-171272IPR001356Homeobox domain
SuperFamilySSF466897.27E-121376IPR009057Homeodomain-like
CDDcd000865.87E-51474No hitNo description
Gene3DG3DSA:1.10.10.602.0E-71471IPR009057Homeodomain-like
PROSITE profilePS5007110.1061873IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MEALSGRVGV KCGRWNPTAE QVKVLTELFR AGLRTPSTEQ IQRISTHLSA FGKVESKNVF  60
YWFQNHKARE RHHHKKRRRG ASSPDSGSND DDGRAAAHEG DADLVLQPPE SKREARSYGH  120
HHRLMTCYVR DVVETEAMWE RPTREVETLE LFPLKSYDLE VDKVRYVRGG GGEQCREISF  180
FDVAAGRDPP LELRLCSFGL *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.329780.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329874120.0
Expression AtlasQ8W0F1-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During embryogenesis and crown root formation, it is expressed prior to the morphological differentiation of the root. {ECO:0000269|PubMed:12904206}.
UniprotTISSUE SPECIFICITY: Specifically expressed in the central cells of the quiescent center (QC) of the root. {ECO:0000269|PubMed:12904206}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269|PubMed:12904206}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g63510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g63510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1022030.0AK102203.1 Oryza sativa Japonica Group cDNA clone:J033087F22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642985.11e-148PREDICTED: WUSCHEL-related homeobox 9
SwissprotQ8W0F11e-150WOX9_ORYSJ; WUSCHEL-related homeobox 9
TrEMBLA0A0D3EWE21e-148A0A0D3EWE2_9ORYZ; Uncharacterized protein
TrEMBLA2WX371e-148A2WX37_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0N5501e-148A0A0E0N550_ORYRU; Uncharacterized protein
TrEMBLI1NTF81e-148I1NTF8_ORYGL; Uncharacterized protein
STRINGLOC_Os01g63510.11e-148(Oryza sativa Japonica Group)
STRINGBGIOSGA000469-PA1e-148(Oryza sativa Indica Group)
STRINGORGLA01G0314800.11e-148(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP84061116
MonocotsOGMP94113643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.15e-36WUSCHEL related homeobox 5
Publications ? help Back to Top
  1. Kamiya N,Nagasaki H,Morikami A,Sato Y,Matsuoka M
    Isolation and characterization of a rice WUSCHEL-type homeobox gene that is specifically expressed in the central cells of a quiescent center in the root apical meristem.
    Plant J., 2003. 35(4): p. 429-41
    [PMID:12904206]
  2. Nardmann J,Werr W
    The shoot stem cell niche in angiosperms: expression patterns of WUS orthologues in rice and maize imply major modifications in the course of mono- and dicot evolution.
    Mol. Biol. Evol., 2006. 23(12): p. 2492-504
    [PMID:16987950]
  3. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]