PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g63460.1
Common NameLOC4324820, Os01g0853700, OsJ_04107, OSNPB_010853700, P0529E05.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 300aa    MW: 33056.3 Da    PI: 7.3015
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g63460.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.65.8e-083177347
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      +W++eE + + +a +q   +   +W+ +a++++ ++t  ++ ++++++
  LOC_Os01g63460.1 31 AWSAEENKVFERALAQVDLDspnRWEMVAAMLP-RKTVIDVMNHYRDL 77
                      7****************99999***********.***********986 PP

2Myb_DNA-binding44.34e-14138182347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE++ ++ + k++G g+W+ I+r++ + Rt+ q+ s+ qky
  LOC_Os01g63460.1 138 PWTEEEHKSFLMGLKKYGRGDWRNISRYFVTSRTPTQVASHAQKY 182
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-52177IPR009057Homeodomain-like
PROSITE profilePS500906.5512478IPR017877Myb-like domain
SMARTSM007174.1E-72880IPR001005SANT/Myb domain
CDDcd001676.80E-73177No hitNo description
SuperFamilySSF466891.24E-103185IPR009057Homeodomain-like
PROSITE profilePS5129416.496131187IPR017930Myb domain
SuperFamilySSF466899.66E-18133187IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-17134185IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-11135181IPR009057Homeodomain-like
SMARTSM007177.6E-12135185IPR001005SANT/Myb domain
PfamPF002491.6E-11138182IPR001005SANT/Myb domain
CDDcd001671.42E-10138183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MMAEALREVL PLPYFPGQPC WYLQERRGAE AWSAEENKVF ERALAQVDLD SPNRWEMVAA  60
MLPRKTVIDV MNHYRDLEND VGSIEAGLVP FPHYSSSLSP ASSGFTLQDW DGSDGGFRRG  120
CYLKRGRAPD QERKKGVPWT EEEHKSFLMG LKKYGRGDWR NISRYFVTSR TPTQVASHAQ  180
KYFIRLNSGG KDKRRSSIHD ITTVNLPEED TSNPSPSPPS VLTTASDQLG SLVDTKPVPP  240
PPSLGAQRHF MSPLPGALGV SHHPYGNVKL EPNASFLAGG GTGPGLDDAI LLQMQCGHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-142697576RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.424060.0panicle| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379886510.0
Expression AtlasQ5N9B7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g63460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g63460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402140.0FJ940214.1 Oryza sativa Japonica Group clone KCS611H03 Myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621447.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H79e-79DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLQ5N9B70.0Q5N9B7_ORYSJ; Myb transcription factor
STRINGLOC_Os01g63460.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.13e-79MYB family protein