PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g63380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 629aa    MW: 72032.1 Da    PI: 6.9665
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g63380.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR182.28.9e-2651137190
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       +fYn+YA +vGFs+rk  + ks  ++ i +++fvCs+eg++++++++    +r+ra tr+gC a++++k + +gk+ ++++++ HnHel 
  LOC_Os01g63380.1  51 EFYNRYAGDVGFSIRKFWHDKS-STNVIRTKKFVCSREGFNKRNTSD--ACQRKRADTRVGCMAEMTIKITPTGKYAIASFSNTHNHELI 137
                       6********************9.5555****************9988..9999***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.3E-2251137IPR004330FAR1 DNA binding domain
PfamPF105517.1E-36259353IPR018289MULE transposase domain
PROSITE profilePS5096610.361457493IPR007527Zinc finger, SWIM-type
PfamPF044342.5E-7465491IPR007527Zinc finger, SWIM-type
SMARTSM005751.4E-8468495IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MAEAPVHPSS SKNHEKEDVG DTNISSTDDA CVQKLEPVIG MEFDDEDIAY EFYNRYAGDV  60
GFSIRKFWHD KSSTNVIRTK KFVCSREGFN KRNTSDACQR KRADTRVGCM AEMTIKITPT  120
GKYAIASFSN THNHELITPS KAHLLRSQRR MTEAQKAQID ILNDSGVRSK EGHEVMSRQA  180
GGRQSLTFTR KDYKNYLRSK RMKSIQEGDT GAILQYLQDK QMENPSFFYA IQVDEDEMMT  240
NIFWADARSV LDFDYFGDVI CFDTTYRTNN YGRPFALFVG VNHHKQTVVF GAALLYDETT  300
STFEWLFETF KRAMSGKEPR TILTDQCAAI INAIGTVFPN STHRLCVWHM YQNAAVHLSH  360
IFQGSKTFKN DFGKCVFDFE EVDEFISAWN KMIEEYNLND NQWLHHLFEI KEKWALVYGR  420
QTFCADMKST QRSESLNALL KRYLHVIDSA KHGEHGFLVK FDPNEIKVSC SCKKFEFVGI  480
LCRHALKVLD HNNIKELPSE YILKRWTKYA KIGSSQANRK CANDEDARVV LARRYGSLCR  540
SYNNILSKAA ENEEAYALLE RTSLELMEQV DQIMQANKSE GKSKVDRNAG GTSTTSEVIP  600
NFTVSNENDQ MPSEVPNDPS ENLQDKHF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.958651e-53leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g63380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g63380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032790.0AP003279.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0529E05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621167.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0P0VAD90.0A0A0P0VAD9_ORYSJ; Os01g0852650 protein
STRINGLOC_Os01g63380.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-113FAR1-related sequence 5