PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g62920.1
Common NameLOC4324855, Os01g0848400, OsJ_04077, OSNPB_010848400, P0005H10.27, qSH1, qSH-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 613aa    MW: 65175.6 Da    PI: 7.9812
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g62920.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.6e-103904271954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+  +++ LAk++gLt +qV++WF N R +
  LOC_Os01g62920.1 390 FEHflHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVR 427
                       554459******************************88 PP

2BELL97.31.3e-31254323372
              BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +e q kk+kL+s++eeV+krY+qy++q+q+v++sFe+vag  +a+p+++lAl+a+++hF+cLk +i +q+
  LOC_Os01g62920.1 254 AEQQWKKTKLISMMEEVCKRYRQYYQQVQAVMASFETVAGFSNAAPFAALALRAMAKHFKCLKSMILNQL 323
                       5899***************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-35179321IPR006563POX domain
PfamPF075261.9E-36184319IPR006563POX domain
PROSITE profilePS5007112.228368431IPR001356Homeobox domain
CDDcd000864.43E-13371432No hitNo description
SMARTSM003897.4E-11371435IPR001356Homeobox domain
SuperFamilySSF466894.06E-17373440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28374435IPR009057Homeodomain-like
PfamPF059206.5E-19388427IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MSSAAGGGGY GGGQGGGAEH HHHHHGHAGH LLLHHHPQHV AGAAVAAAAA AAGGQMYHVP  60
QHSRREKLRF PPDAGDSPPP HGHGHGHAPQ QQQQHGSWPP PPAFYSYASS SSSYSPHSPT  120
LAQAQLVAHG LAPPLPQIPT QNFSLSLSSA SSNPPPPQAQ PRRQLGGLAQ ATGPFGPFTG  180
YAAVLGRSRF LGPAEKLFEE ICDVGGAASH VDRTISDEGL LDADPMDGVD HDVVDHDLGG  240
ADRAAADAGP ISGAEQQWKK TKLISMMEEV CKRYRQYYQQ VQAVMASFET VAGFSNAAPF  300
AALALRAMAK HFKCLKSMIL NQLRNTSNKV AVKDGLNKEI AVFGLAGGSS GGAGLQRANS  360
ASAFGQPHNI WRPQRGLPER AVSVLRAWLF EHFLHPYPTD GDKQMLAKQT GLTRNQVSNW  420
FINARVRLWK PMVEEIHNLE MRQMHKHSVV DKGQHSVHHQ AQHSSQCSGN PSVPSDSHPG  480
QSSSITRNHN TAASQGFPDE LSQMSQSIQG QVSFAYNGLT SQHNIASPHH QHQQVGGVGI  540
GGGNGGVSLT LGLHQNNRVC IAEPLPAALP ANLAHRFGLE EVSDAYVMSS FGGQDRHFGK  600
EIGGHLLHDF VG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A6e-17377435563Homeobox protein Meis2
4xrm_B6e-17377435563Homeobox protein Meis2
4xrs_A5e-17377434158Homeobox protein Meis1
4xrs_B5e-17377434158Homeobox protein Meis1
5bng_A5e-17377435159Homeobox protein Meis2
5bng_B5e-17377435159Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.196390.0flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO193521000.0
Expression AtlasQ941S9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g62920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g62920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0713310.0AB071331.1 Oryza sativa Japonica Group qSH-1 mRNA for qSH-1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641948.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA9XWP80.0A9XWP8_ORYSI; Putative transcription factor qSH-1
TrEMBLA9XWQ20.0A9XWQ2_ORYSA; Putative transcription factor qSH-1
TrEMBLA9XWR30.0A9XWR3_ORYRU; Putative transcription factor qSH-1
TrEMBLA9XWS00.0A9XWS0_ORYNI; Putative transcription factor qSH-1
TrEMBLA9XWS10.0A9XWS1_9ORYZ; Putative transcription factor qSH-1
TrEMBLQ941S90.0Q941S9_ORYSJ; Os01g0848400 protein
STRINGLOC_Os01g62920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.18e-58BEL1-like homeodomain 8
Publications ? help Back to Top
  1. Konishi S, et al.
    An SNP caused loss of seed shattering during rice domestication.
    Science, 2006. 312(5778): p. 1392-6
    [PMID:16614172]