PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g62660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 254aa    MW: 26108.2 Da    PI: 5.5857
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g62660.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.53.4e-29140193155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r++WtpeLH+rFveav++L G++ A+Pk+i++lm+v+gLt+e+v+SHLQkYRl
  LOC_Os01g62660.1 140 KARMVWTPELHHRFVEAVAHL-GEKGAVPKAIVRLMNVDGLTRENVASHLQKYRL 193
                       68*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.18E-19137197IPR009057Homeodomain-like
PROSITE profilePS5129411.768139196IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-29139197IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-24140193IPR006447Myb domain, plants
PfamPF002497.1E-10142192IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MLSARGGRPH DADAPLPSSS SSSSSSSSSS PSRRMVDAAA ASGDACGRVT EWETGLPAPG  60
EMTPVSHQLV PPALAAAFGI DLAAVGVLLP SPSVDSPVSH LFFPVDEDDD EDEEGEGEGG  120
NDDAPAAAAA GGGGGRCGKK ARMVWTPELH HRFVEAVAHL GEKGAVPKAI VRLMNVDGLT  180
RENVASHLQK YRLYLKRTRV AATPPPSPPP PPPPPPPLPP AMYVPCFAAK PPLDAANRSD  240
SPPSRTSDAT TKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-21139197462ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.100500.0callus| flower| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329766770.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g62660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g62660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032510.0AP003251.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0446B05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611233.10.0PREDICTED: WAS protein family homolog 1 isoform X1
TrEMBLA0A0E0FVM80.0A0A0E0FVM8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0N4W00.0A0A0E0N4W0_ORYRU; Uncharacterized protein
STRINGLOC_Os01g62660.11e-180(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11571753
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.18e-29G2-like family protein