PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g62510.1
Common NameOsJ_04042, P0406G08.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 204aa    MW: 21483.5 Da    PI: 5.042
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g62510.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY54.32.7e-1717542158
                      -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
              WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58
                        sYY+Cts++C++kk+ve+s++dp+++++tYeg+H+h
  LOC_Os01g62510.1 17 LWSYYKCTSSRCSAKKHVEKSTDDPEMLIVTYEGSHHH 54
                      569**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007742.6E-9356IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-151555IPR003657WRKY domain
PfamPF031061.2E-121554IPR003657WRKY domain
SuperFamilySSF1182909.81E-131856IPR003657WRKY domain
PROSITE profilePS5081115.7091957IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MEEDDGLALM TGANQSLWSY YKCTSSRCSA KKHVEKSTDD PEMLIVTYEG SHHHGPQPLF  60
PPHIAQPPPP TSVVGFSAAS GAGPPPSSPA AAARKRKNYV RAAFSPTTSE DDGDGAGRLR  120
PEWPQDDGTS CDVAELRRRG DAEHAAPRRV ATDRSCDDGG GGGSTSASSS VARADAATAL  180
SSDSPPTIWS CLDWPWSQET LFL*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8S2A6
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g62510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g62510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032400.0AP003240.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0406G08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635485.11e-130PREDICTED: uncharacterized protein LOC107276405
TrEMBLQ8S2A61e-147Q8S2A6_ORYSJ; Uncharacterized protein
STRINGLOC_Os01g62510.11e-146(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP131442633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.16e-13WRKY family protein