PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g62460.3
Common NameLOC4327499, Os01g0842200, OSNPB_010842200, P0406G08.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 706aa    MW: 78998.1 Da    PI: 6.5124
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g62460.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS387.51.5e-1183296982374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cA+ v+++d + a++lL++++++a  +gd  qRla++f+++L+arla+++s++yk  + ++ +    +++l+a++l+  ++P+ k+s
  LOC_Os01g62460.3 329 ETLLIHCAQSVATDDRRSATELLKQIRQHAHANGDGDQRLAHCFANGLEARLAGTGSQIYKNYTITRLP---CTDVLKAYQLYLAACPFKKIS 418
                       789************************************************************999999...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       h  aNq+Il+ave++++vHi+D++i +G+QWp+L+q L++Rp+gpp+lRiTg++ p++g   +e++eetg+ L+++A++++vpfef++ +a+r
  LOC_Os01g62460.3 419 HYFANQTILNAVEKAKKVHIVDYGIYYGFQWPCLIQRLSNRPGGPPKLRITGIDTPQPGfrPAERTEETGRYLSDYAQTFNVPFEFQA-IASR 510
                       ****************************************************************************************.7*** PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       +e++++e+L+++++E+l+Vn++++ ++l+desv  es+r+  Lk++++++P+v+++   + ++n++ F++rf eal +ysa+fd+le+++p++
  LOC_Os01g62460.3 511 FEAVRMEDLHIEEDEVLIVNCMFKFKNLMDESVVAESPRNMALKTIRKMNPHVFIHGVVNGSYNAPFFVTRFREALFHYSAIFDMLETNIPKD 603
                       ********************************************************************************************* PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       +e+r  +E +l++re+ nv++ceg er er et+++W+ r +++GFk++pl+++++k a+  +r +++d + ++e++ +l++gWk+r L+++S
  LOC_Os01g62460.3 604 NEQRLLIESALFSREAINVISCEGLERMERPETYKQWQVRNQRVGFKQLPLNQDMMKRAREKVRCYHKD-FIIDEDNRWLLQGWKGRILFALS 695
                       *******************************************************************77.*********************** PP

              GRAS 372 aWr 374
                        W+
  LOC_Os01g62460.3 696 TWK 698
                       **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.115302679IPR005202Transcription factor GRAS
PfamPF035145.3E-116329698IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MLMAEDIDEK FEHYPVNADD LLAAEKPFLE ILADQSPYSG GSSVESPDGS SAANSCNSLS  60
PCNCSSSSDG LGAVPQTPVL EFPTAAFSQT PQLYGDLIPT GGMVESGGAW PYDPTEFYQL  120
QTKPVRENLP SQSSSFASSN GSSVTFSEGF ESLLSPAGVL PDVSLNDFVV QNQQALQFRR  180
GFQEASKFLP DESKLVIDVD KLYSGDEGSR FLGEVRQEKK LVKVKTETSD VESAGHRGKK  240
HFYGDDLDAE EGRCSKHSAQ GIDTDHLVRD LMDKVLLCNG ETCSKGVKEL REALQHDVAK  300
HSGGGHGKGS SHGKGRGKKQ PKKEVVDLET LLIHCAQSVA TDDRRSATEL LKQIRQHAHA  360
NGDGDQRLAH CFANGLEARL AGTGSQIYKN YTITRLPCTD VLKAYQLYLA ACPFKKISHY  420
FANQTILNAV EKAKKVHIVD YGIYYGFQWP CLIQRLSNRP GGPPKLRITG IDTPQPGFRP  480
AERTEETGRY LSDYAQTFNV PFEFQAIASR FEAVRMEDLH IEEDEVLIVN CMFKFKNLMD  540
ESVVAESPRN MALKTIRKMN PHVFIHGVVN GSYNAPFFVT RFREALFHYS AIFDMLETNI  600
PKDNEQRLLI ESALFSREAI NVISCEGLER MERPETYKQW QVRNQRVGFK QLPLNQDMMK  660
RAREKVRCYH KDFIIDEDNR WLLQGWKGRI LFALSTWKPD NRSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-523326988375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.118660.0callus| flower| leaf| panicle| root| seed| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154409820.0
Expression AtlasQ5N9X3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g62460.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g62460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032400.0AP003240.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0406G08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619294.10.0PREDICTED: scarecrow-like protein 9 isoform X1
SwissprotO809331e-178SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0E0N4T10.0A0A0E0N4T1_ORYRU; Uncharacterized protein
TrEMBLQ5N9X30.0Q5N9X3_ORYSJ; Os01g0842200 protein
STRINGLOC_Os01g62460.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-177GRAS family protein