PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g62410.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 500aa    MW: 55086.1 Da    PI: 7.9941
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g62410.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.39.5e-203177148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++++d+vk++G+  W+ Ia+ ++ gR +kqc++rw+++l
  LOC_Os01g62410.2 31 KGPWTQEEDDQIIDLVKKYGPTKWSVIAKALP-GRIGKQCRERWHNHL 77
                      79******************************.*************97 PP

2Myb_DNA-binding60.63.3e-1983126146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +++WTteE++ l++a++ +G++ W+ Ia+ ++ gRt++++k++w++
  LOC_Os01g62410.2  83 KDAWTTEEEQALINAHRIYGNK-WAEIAKVLP-GRTDNSIKNHWNS 126
                       679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.24125IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.2E-13641IPR009057Homeodomain-like
PROSITE profilePS5129431.7572681IPR017930Myb domain
SuperFamilySSF466892.97E-3228124IPR009057Homeodomain-like
SMARTSM007176.4E-193079IPR001005SANT/Myb domain
PfamPF002491.5E-183177IPR001005SANT/Myb domain
CDDcd001678.02E-173377No hitNo description
Gene3DG3DSA:1.10.10.605.1E-274284IPR009057Homeodomain-like
SMARTSM007175.3E-1882130IPR001005SANT/Myb domain
PROSITE profilePS5129423.86382132IPR017930Myb domain
PfamPF002495.0E-1783126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2385131IPR009057Homeodomain-like
CDDcd001671.02E-1485128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MYLYAAECFP YRTEVQCLHR WQKVLNPELI KGPWTQEEDD QIIDLVKKYG PTKWSVIAKA  60
LPGRIGKQCR ERWHNHLNPE IRKDAWTTEE EQALINAHRI YGNKWAEIAK VLPGRTDNSI  120
KNHWNSSLRK KQDMYNTSNN MVVPKLLVHD KFKDKPKLMA MEGHLDLNKA PIINSKDQPG  180
TAHRSNCSGF LSRSSLPTAQ PLTSREASVV DGSAVTLVAQ ALESDSVRGK GLEIDSVHEK  240
GLEVNSAPDH TGNSWTIQLE AAPSKGEAEL SLKNEARSLG PLCYQIPNME DVVPVSSSLF  300
SDHLTGNHTS EHCGDDILSP AGCTTPPPTK GKLTSQLSVD SILKSAANSF PGTPSILKRR  360
KRDKSTPVSA SEMKISGSNT DRFYTPMGME PATATPESFK TTSFLSLGSL DGSVKSFDVS  420
PQYRARSKRM ALTKTVEKQL DFSSDGLDTC GSEILNSSCN NSQSTLSITE APKLKEKEHA  480
VQLENLTKNF AHTTNLDVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-64613133158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-64613133158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1358363RRKRDK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.381770.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329765380.0
Expression AtlasD6BV30-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g62410.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g62410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402120.0FJ940212.1 Oryza sativa Japonica Group clone KCS635B12 Myb-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616493.10.0PREDICTED: transcription factor MYB122
RefseqXP_015616500.10.0PREDICTED: transcription factor MYB122
TrEMBLD6BV300.0D6BV30_ORYSJ; Myb transcription factor
TrEMBLQ5QT310.0Q5QT31_ORYSA; Transcription factor myb
STRINGLOC_Os01g62410.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.27e-82myb domain protein 3r-5