PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g62410.1
Common NameLOC4327399, Os01g0841500, OSNPB_010841500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 588aa    MW: 64100.1 Da    PI: 8.4025
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g62410.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-1867113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT+eEde l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  LOC_Os01g62410.1  67 KGGWTPEEDETLRKAVEAYKGRNWKKIAECFP-YRTEVQCLHRWQKVL 113
                       688*****************************.************986 PP

2Myb_DNA-binding621.2e-19119165148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd++++d+vk++G+  W+ Ia+ ++ gR +kqc++rw+++l
  LOC_Os01g62410.1 119 KGPWTQEEDDQIIDLVKKYGPTKWSVIAKALP-GRIGKQCRERWHNHL 165
                       79******************************.*************97 PP

3Myb_DNA-binding60.34.1e-19171214146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +++WTteE++ l++a++ +G++ W+ Ia+ ++ gRt++++k++w++
  LOC_Os01g62410.1 171 KDAWTTEEEQALINAHRIYGNK-WAEIAKVLP-GRTDNSIKNHWNS 214
                       679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0962113IPR017930Myb domain
SMARTSM007179.8E-1766115IPR001005SANT/Myb domain
PfamPF002493.2E-1667113IPR001005SANT/Myb domain
SuperFamilySSF466893.8E-1668123IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-2469129IPR009057Homeodomain-like
CDDcd001675.28E-1570113No hitNo description
PROSITE profilePS5129431.757114169IPR017930Myb domain
SuperFamilySSF466893.59E-32116212IPR009057Homeodomain-like
SMARTSM007176.4E-19118167IPR001005SANT/Myb domain
PfamPF002491.9E-18119165IPR001005SANT/Myb domain
CDDcd001671.62E-16121165No hitNo description
Gene3DG3DSA:1.10.10.607.0E-27130173IPR009057Homeodomain-like
PROSITE profilePS5129423.863170220IPR017930Myb domain
SMARTSM007175.3E-18170218IPR001005SANT/Myb domain
PfamPF002496.1E-17171214IPR001005SANT/Myb domain
CDDcd001671.93E-14173216No hitNo description
Gene3DG3DSA:1.10.10.601.2E-22174219IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MGAMAMVEQE GCVENRQPLA ASSSSVSDGS SYGGGGGGLA QMSPPVSSSA NSISGLRRTS  60
GPIRRAKGGW TPEEDETLRK AVEAYKGRNW KKIAECFPYR TEVQCLHRWQ KVLNPELIKG  120
PWTQEEDDQI IDLVKKYGPT KWSVIAKALP GRIGKQCRER WHNHLNPEIR KDAWTTEEEQ  180
ALINAHRIYG NKWAEIAKVL PGRTDNSIKN HWNSSLRKKQ DMYNTSNNMV VPKLLVHDKF  240
KDKPKLMAME GHLDLNKAPI INSKDQPGTA HRSNCSGFLS RSSLPTAQPL TSREASVVDG  300
SAVTLVAQAL ESDSVRGKGL EIDSVHEKGL EVNSAPDHTG NSWTIQLEAA PSKGEAELSL  360
KNEARSLGPL CYQIPNMEDV VPVSSSLFSD HLTGNHTSEH CGDDILSPAG CTTPPPTKGK  420
LTSQLSVDSI LKSAANSFPG TPSILKRRKR DKSTPVSASE MKISGSNTDR FYTPMGMEPA  480
TATPESFKTT SFLSLGSLDG SVKSFDVSPQ YRARSKRMAL TKTVEKQLDF SSDGLDTCGS  540
EILNSSCNNS QSTLSITEAP KLKEKEHAVQ LENLTKNFAH TTNLDVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-72662195158MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-72662195158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1446451RRKRDK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.381770.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329765380.0
Expression AtlasQ0JHU7-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g62410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g62410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402120.0FJ940212.1 Oryza sativa Japonica Group clone KCS635B12 Myb-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616493.10.0PREDICTED: transcription factor MYB122
RefseqXP_015616500.10.0PREDICTED: transcription factor MYB122
TrEMBLQ0JHU70.0Q0JHU7_ORYSJ; Myb-like protein
STRINGLOC_Os01g62410.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-108myb domain protein 3r-5