PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g62310.1
Common NameLOC4327390, Os01g0840300, P0408C03.23, WOX5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 314aa    MW: 33206.4 Da    PI: 9.9192
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g62310.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-2043102357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        R+t+tkeq+ +Le l+++  r+p+ae++++++++l    +++ ++V++WFqN++a++++
  LOC_Os01g62310.1  43 ARWTPTKEQIAVLEGLYRQgLRTPTAEQIQQITARLrehgHIEGKNVFYWFQNHKARQRQ 102
                       7*****************99**************************************96 PP

2Wus_type_Homeobox115.52.6e-3742104365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RWtPt+eQi +Le ly++GlrtP++e+iq+ita+L+e+G+ie+kNVfyWFQN+kaR+rqkq
   LOC_Os01g62310.1  42 NARWTPTKEQIAVLEGLYRQGLRTPTAEQIQQITARLREHGHIEGKNVFYWFQNHKARQRQKQ 104
                        78***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.72238103IPR001356Homeobox domain
SMARTSM003892.3E-540107IPR001356Homeobox domain
SuperFamilySSF466892.91E-1243109IPR009057Homeodomain-like
PfamPF000462.6E-1843102IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.7E-843102IPR009057Homeodomain-like
CDDcd000866.02E-54498No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
METTTTTLGG GGGGRAGGFS DPPSPLSPPL SPASAAAAAL ANARWTPTKE QIAVLEGLYR  60
QGLRTPTAEQ IQQITARLRE HGHIEGKNVF YWFQNHKARQ RQKQKQQSFD YFSKLFRRPP  120
PLPVLHRPLA RPFPLAMAPT AMPPPPPPPA TTTTAACNAG GVMFRTPSFM PVATNNASYY  180
PQQQTPLLYP GMEVCPHDKS TAQPPATTTM YLQAPPSSAH LAAAAGRGAA EAEGHGRRGG  240
GAGGRETLQL FPLQPTFVLP DHKPLRAGSA CAAVSPTTPS ASASFSWESE SSDSPSSEAP  300
PFYDFFGVHS GGR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.160130.0callus| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8LR86
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g62310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g62310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032410.0AP003241.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0408C03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644226.10.0PREDICTED: WUSCHEL-related homeobox 5
SwissprotA2WWU70.0WOX5_ORYSI; WUSCHEL-related homeobox 5
SwissprotQ8LR860.0WOX5_ORYSJ; WUSCHEL-related homeobox 5
TrEMBLA0A0E0FVL90.0A0A0E0FVL9_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QSY70.0A0A0E0QSY7_ORYRU; Uncharacterized protein
STRINGBGIOSGA000516-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g62310.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP85821116
MonocotsOGMP75093548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-27WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Nardmann J,Werr W
    The shoot stem cell niche in angiosperms: expression patterns of WUS orthologues in rice and maize imply major modifications in the course of mono- and dicot evolution.
    Mol. Biol. Evol., 2006. 23(12): p. 2492-504
    [PMID:16987950]
  2. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]