PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g61810.1
Common NameHAP3A, NFYB2, Os01g0834400, P0460C04.37, P0506B12.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 127aa    MW: 13891 Da    PI: 5.2681
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g61810.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.37.2e-5632125194
             NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrkting+dll+a++tlGfe+yv+plk+yl+kyrel
  LOC_Os01g61810.1  32 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLFAMGTLGFEEYVDPLKIYLHKYREL 124
                       69*****************************************************************************************98 PP

             NF-YB  94 e 94 
                        
  LOC_Os01g61810.1 125 V 125
                       5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.8E-5230124IPR009072Histone-fold
SuperFamilySSF471134.04E-3935124IPR009072Histone-fold
PfamPF008081.6E-2838102IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-226684No hitNo description
PROSITE patternPS0068506985IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-2285103No hitNo description
PRINTSPR006151.3E-22104122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MMMMDLGFLE GGAGMADAGH DESGSPPRSG GVREQDRFLP IANISRIMKK AVPANGKIAK  60
DAKETLQECV SEFISFVTSE ASDKCQKEKR KTINGEDLLF AMGTLGFEEY VDPLKIYLHK  120
YRELVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-4931123193NF-YB
4awl_B5e-4931123294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-4931123294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B5e-4932123192Transcription factor HapC (Eurofung)
4g92_B5e-4932123192Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.226370.0flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329933510.0
Expression AtlasQ5QMG3-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14617083}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g61810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g61810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0954380.0AB095438.1 Oryza sativa Japonica Group OsHAP3A mRNA for HAP3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611518.19e-87PREDICTED: nuclear transcription factor Y subunit B-2 isoform X1
SwissprotQ5QMG36e-91NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2
TrEMBLA0A0D9YGX61e-87A0A0D9YGX6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FVE31e-87A0A0E0FVE3_ORYNI; Uncharacterized protein
TrEMBLA0A0E0N4L51e-87A0A0E0N4L5_ORYRU; Uncharacterized protein
STRINGLOC_Os01g61810.12e-87(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.34e-61nuclear factor Y, subunit B8
Publications ? help Back to Top
  1. Miyoshi K,Ito Y,Serizawa A,Kurata N
    OsHAP3 genes regulate chloroplast biogenesis in rice.
    Plant J., 2003. 36(4): p. 532-40
    [PMID:14617083]