PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g61080.1
Common NameLOC4327518, Os01g0826400, OsJ_03928, OSNPB_010826400, WRKY24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 556aa    MW: 59305.7 Da    PI: 7.109
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g61080.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.11.8e-33220276259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh 
  LOC_Os01g61080.1 220 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITEIVYKGTHNHA 276
                       8****************************************.***************7 PP

2WRKY105.92.1e-33384442159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct+agCpv+k+ver+++d ++v++tYeg+Hnh+
  LOC_Os01g61080.1 384 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKHVERASHDLRAVITTYEGKHNHD 442
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-28212278IPR003657WRKY domain
PROSITE profilePS5081123.479214278IPR003657WRKY domain
SuperFamilySSF1182902.22E-25215278IPR003657WRKY domain
SMARTSM007742.5E-36219277IPR003657WRKY domain
PfamPF031062.0E-25220275IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-37369444IPR003657WRKY domain
SuperFamilySSF1182901.83E-29376444IPR003657WRKY domain
PROSITE profilePS5081138.687379444IPR003657WRKY domain
SMARTSM007741.2E-38384443IPR003657WRKY domain
PfamPF031069.3E-26385442IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MTTSSSGSVE TSANSRLGTF SFASASFTDL LGGNAGAGGG GVSRYKAMTP PSLPLSPPPV  60
SPSSFFNSPI GMNQADFLGS PVLLTSSIFP SPTTGAFASQ HFDWRPEVAA AQSADQGGKD  120
EQRNSYSDFS FQTAPASEEA VRTTTFQPPV PPAPLGDEAY RSQQQQQPWG YQQQPAGMDA  180
GANAASFGAA PFQATSSEMA PQVQGGGGYS QPQSQRRSSD DGYNWRKYGQ KQVKGSENPR  240
SYYKCTFPNC PTKKKVERSL DGQITEIVYK GTHNHAKPQN TRRNSGSSAA QVLQSGGDMS  300
EHSFGGMSGT AATPENSSAS FGDDEIRVGS PRAGNGGGDE FDDDEPDSKR WRKDGDGEGI  360
SMAGNRTVRE PRVVVQTMSD IDILDDGYRW RKYGQKVVKG NPNPRSYYKC TTAGCPVRKH  420
VERASHDLRA VITTYEGKHN HDVPAARGSA ALYRPAPPAA AATSSHPYLP NQPPPMSYQP  480
TGPQPYALRP DGFGGQGPFG GVVGGSSFGG FSGFDDARGS YMSQHQQQQR QNDAMHASRA  540
KEEPGDDMFF QNSLY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36211445878Probable WRKY transcription factor 4
2lex_A3e-36211445878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.315210.0leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329924080.0
Expression AtlasQ6IEQ7-
Function -- GeneRIF ? help Back to Top
  1. isolated and characterized ABF1 (ABA responsive element binding factor 1) gene that encodes a bZIP transcription factor
    [PMID: 20039193]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g61080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g61080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8706080.0AY870608.1 Oryza sativa (japonica cultivar-group) WRKY24 mRNA, complete cds.
GenBankAK1071990.0AK107199.1 Oryza sativa Japonica Group cDNA clone:002-125-B01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619871.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P51e-102WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLQ6IEQ70.0Q6IEQ7_ORYSJ; Os01g0826400 protein
STRINGLOC_Os01g61080.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.16e-96WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Zhang ZL, et al.
    A rice WRKY gene encodes a transcriptional repressor of the gibberellin signaling pathway in aleurone cells.
    Plant Physiol., 2004. 134(4): p. 1500-13
    [PMID:15047897]
  2. Xie Z, et al.
    Annotations and functional analyses of the rice WRKY gene superfamily reveal positive and negative regulators of abscisic acid signaling in aleurone cells.
    Plant Physiol., 2005. 137(1): p. 176-89
    [PMID:15618416]
  3. Amir Hossain M, et al.
    The bZIP transcription factor OsABF1 is an ABA responsive element binding factor that enhances abiotic stress signaling in rice.
    Plant Mol. Biol., 2010. 72(4-5): p. 557-66
    [PMID:20039193]