PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g60270.1
Common NameLOC4327441, Os01g0818400, OsJ_03880, P0454H12.31, WOX8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 268aa    MW: 30238.7 Da    PI: 6.3521
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g60270.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.61.6e-2190150257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       r+R+t+t+ ql++Le+ F + n +ps++++++++++l    +++e++V++WFqNrRa+ k+
  LOC_Os01g60270.1  90 RQRWTPTPMQLQILENIFDQgNGTPSKQKIKDITAELsqhgQISETNVYNWFQNRRARSKR 150
                       89*****************99**************************************97 PP

2Wus_type_Homeobox104.38.2e-3489152265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+++++G  tP+k++i++itaeL+++G+i+++NV++WFQNr+aR+++kq
   LOC_Os01g60270.1  89 ARQRWTPTPMQLQILENIFDQGNGTPSKQKIKDITAELSQHGQISETNVYNWFQNRRARSKRKQ 152
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1785155IPR009057Homeodomain-like
PROSITE profilePS5007114.83586151IPR001356Homeobox domain
SMARTSM003891.9E-1488155IPR001356Homeobox domain
SuperFamilySSF466892.01E-1889153IPR009057Homeodomain-like
CDDcd000861.45E-1390152No hitNo description
PfamPF000462.6E-1990150IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEWDKAKASS GEAVDDRGGG EGGLGYVKVM TDEQMEVLRK QISIYATICE QLVEMHRALT  60
AQQDSIAGMR LGNLYCDPLM VPGGHKITAR QRWTPTPMQL QILENIFDQG NGTPSKQKIK  120
DITAELSQHG QISETNVYNW FQNRRARSKR KQAALPNNNA ESEAEADEES PTDKKPKSDR  180
PLHQNIAMRD HNSERISEMH HFDTEHEQIR RMMYASNDSS SRSSGSLGQM SFYDNVMSNP  240
RIDHFLGKVE SPGSFPHMRS GESFDMY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143151RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.248930.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166390180.0
Expression AtlasQ5QMM3-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g60270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g60270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0685850.0AK068585.1 Oryza sativa Japonica Group cDNA clone:J013151P17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626455.10.0PREDICTED: WUSCHEL-related homeobox 8
SwissprotQ5QMM30.0WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A0E0FUZ40.0A0A0E0FUZ4_ORYNI; Uncharacterized protein
TrEMBLB8ABA90.0B8ABA9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA004695-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g60270.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18731639
MonocotsOGMP38983776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.12e-71WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Nardmann J,Werr W
    The shoot stem cell niche in angiosperms: expression patterns of WUS orthologues in rice and maize imply major modifications in the course of mono- and dicot evolution.
    Mol. Biol. Evol., 2006. 23(12): p. 2492-504
    [PMID:16987950]
  2. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]